Details for Capsella Locus Carubv10015883m

Position : scaf_3 ( 5`- 3113281 .. 3114898 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015883m

Protein [Map View]
MEDHHHQNHQVQYGIAQPSLHFSSDLFGFNLVSAPDQHHRPHLTDHEISFLPRGIQGLTVAGNNSNSIVASTSCARGGFS
GFTDGGGTGRWPRQETLMLLEVRSRLDHKFKESNQKGPLWDEVSRIMSEEHGYTRSGKKCREKFENLYKYYKKTKEGKAG
RRQDGKNYRFFRQLEAIYGESKDSVSCYDNSQFIMTNALHSFHAPNIHHNAVSHIHQNPLSNNTQSLSISNNLNSSSELD
ISSSSEGNVSTRSEGMNWKAKIKEFIGIHIERLIEKQDFWLEKLVKTVEDKEHQRMVKEEEWKRVEAARIEKERSLWTKE
RERMEARDVAVIEALQYLTGKALIRPNSSSPTERINGNISDQTMADEENKSKMEKKIMSKKRKEKWSSHGGNQLRIKENT
MMIYDNQEDPSCDVEQGHHEGYSPSNSKEGNPSCGIAMAASTNCFPMLVGDGDQNSWEGYGLKLRKEDNHQ*

DNA
ATGGAGGACCATCATCATCAAAACCACCAAGTTCAGTACGGTATAGCGCAACCATCTCTTCATTTCTCATCTGATCTCTT
CGGCTTCAACCTCGTGTCGGCGCCGGACCAGCACCATCGTCCTCATTTGACCGACCATGAGATAAGTTTCTTGCCACGTG
GTATACAAGGGCTTACGGTGGCTGGAAACAACAGTAACTCTATAGTAGCGAGCACAAGCTGTGCTCGTGGTGGGTTTAGT
GGCTTTACCGACGGTGGAGGAACAGGGAGGTGGCCGAGGCAAGAGACGTTGATGTTGCTGGAGGTCCGATCTCGTCTTGA
TCACAAGTTCAAAGAATCCAATCAAAAGGGTCCTCTTTGGGATGAAGTTTCTAGGATTATGTCCGAGGAACATGGATACA
CTAGGAGTGGCAAGAAGTGCAGAGAGAAGTTTGAGAATCTGTACAAGTACTATAAAAAGACAAAAGAAGGCAAAGCTGGT
CGACGTCAAGATGGTAAAAACTATAGATTTTTCCGGCAGCTTGAAGCCATCTACGGCGAATCCAAAGACTCAGTTTCTTG
CTATGACAACTCGCAGTTCATAATGACTAATGCTCTCCATAGTTTTCACGCTCCGAACATTCACCACAACGCTGTCAGTC
ATATTCATCAGAATCCCTTGAGCAATAATACTCAAAGCCTTAGCATTTCTAACAATTTGAACTCATCCTCCGAGTTGGAT
ATAAGTTCCTCCTCCGAAGGAAACGTATCTACTAGAAGCGAGGGGATGAACTGGAAGGCAAAGATCAAGGAATTCATTGG
TATTCATATTGAGAGGCTAATAGAGAAGCAAGATTTTTGGCTTGAGAAGTTGGTGAAGACTGTGGAAGACAAAGAGCATC
AAAGGATGGTTAAGGAAGAGGAATGGAAAAGGGTTGAAGCAGCAAGAATCGAAAAAGAACGTTCGTTGTGGACAAAGGAA
AGGGAGAGGATGGAAGCTCGGGATGTTGCGGTGATTGAGGCCTTGCAGTACCTTACGGGGAAGGCATTGATAAGGCCGAA
CTCTTCATCCCCTACAGAGAGGATCAATGGGAACATAAGCGACCAAACGATGGCTGATGAAGAAAATAAGAGCAAGATGG
AGAAAAAAATAATGAGCAAGAAAAGGAAAGAGAAGTGGTCAAGCCACGGTGGGAATCAACTGAGAATCAAAGAGAATACG
ATGATGATATATGACAATCAAGAAGACCCGAGCTGCGATGTTGAGCAAGGCCATCATGAAGGCTATTCACCTTCAAACTC
CAAGGAAGGAAACCCGAGCTGCGGCATTGCTATGGCGGCTAGTACAAACTGCTTTCCAATGCTCGTTGGAGATGGAGATC
AAAACTCGTGGGAGGGTTATGGTTTGAAGCTAAGGAAAGAAGATAATCATCAGTAA