Details for Capsella Locus Carubv10015881m

Position : scaf_3 ( 5`- 2863249 .. 2864665 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015881m

Protein [Map View]
MMKLEGGLLQWSRSSLIPSIYTTINKTHFSISACVIERNHQLTAKERRQLRNERRESKSGYSWREEVEEKLIKKPKKRYA
TWTEELNLDTLAESGPQWWVVRVSRLRGHETAQILARALARQFPEMEFTVYAPSVQVKRKLKNGSISVKPKPVFPGCIFI
RCILNKEIHDSIREVDGVGGFIGSKVGNTKRQINKPRPVDDSDLEAIFKQAKEEQEKADSEFEEAERAEQEATLLASQNS
NSDVIEAVAESKPKRAPRKATLATETKGKKKKLVAGSTVRVLSGTFAEFVGNFKKLNRKTAKATVGFSLFGKETLVEIDI
NELVLEIQS*

DNA
ATGATGAAGCTGGAAGGGGGACTTCTCCAATGGAGTCGTAGTAGCTTAATCCCATCGATTTATACGACAATCAACAAAAC
CCATTTCTCTATCTCCGCCTGTGTCATCGAGCGGAATCACCAGCTTACGGCGAAAGAGAGACGGCAGCTCCGGAACGAGC
GGCGGGAGAGCAAATCAGGGTATAGCTGGCGAGAAGAAGTTGAAGAAAAGTTGATTAAGAAGCCAAAGAAACGGTACGCG
ACGTGGACGGAGGAGCTGAATTTGGACACTTTGGCGGAGTCGGGTCCGCAATGGTGGGTGGTTAGGGTTTCTAGACTTCG
TGGTCACGAGACTGCTCAAATCTTAGCTCGAGCTCTCGCTCGTCAATTCCCTGAAATGGAATTCACGGTGTATGCTCCAT
CTGTTCAGGTGAAGAGAAAGCTGAAGAACGGTTCTATATCCGTAAAACCGAAACCTGTGTTCCCTGGTTGCATTTTCATC
AGATGTATATTGAACAAAGAGATACATGACTCCATTAGAGAAGTTGATGGAGTTGGAGGTTTCATAGGCTCAAAAGTTGG
AAATACCAAGAGACAGATTAATAAACCGAGACCAGTAGACGACAGTGATTTGGAAGCCATTTTCAAACAAGCAAAAGAAG
AACAAGAGAAAGCAGACAGTGAGTTCGAGGAAGCAGAAAGAGCTGAACAAGAAGCGACCTTACTAGCCTCACAGAATTCT
AATTCAGATGTTATTGAGGCTGTAGCAGAATCTAAACCGAAACGAGCCCCGAGAAAAGCTACACTTGCTACTGAAACAAA
GGGGAAAAAGAAGAAACTTGTAGCTGGTTCTACAGTTCGAGTTTTATCAGGAACATTCGCAGAATTTGTTGGAAACTTTA
AGAAACTGAACCGCAAAACTGCAAAGGCAACGGTGGGATTTAGTTTGTTTGGAAAGGAGACACTAGTGGAAATTGACATC
AATGAACTTGTTCTTGAGATTCAATCTTAG