Details for Capsella Locus Carubv10015868m

Position : scaf_3 ( 5`- 8270067 .. 8272933 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015868m

Protein [Map View]
MDTPQKSITQIGTPVSKLKAEDSPVFNYICSLSPIKSTKSIPITHTLSSLNFTSPPSVFTSPHAVSHKESRFRSQVNSSD
HSKDGVGSNEEAGSIGEKGKEEALTEIEQSQIPKNECNTPRVANDVRDNGCCEDGGMNLVKMCDNVKPKSDTPDWGTLIS
ATTELIYNLTSESEAYSCLLKRTSNSGEHVRGGTMSTLESVSKTNVANNENESFDDLSISHRGVRRRCLDFEIPRNSQQT
LGESSSSCVVPSIGLHLNAIPMSSKDNNVVNEYSFSGNIKVGSQSFTTSDLHSKHHIVRENEIGKDAGQALEEFPKSSAL
EGLPISPKKKRRKSEQSGEGESSCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKSIHEDVVLATRKQIESRNPL
AFAPKVIRSSDSIIEVGDDTSKTPASARHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNAFGRKDGSLFEQDEE
NEVSGKIVTTKTQSNVELFNPLPSTPMPLRQPLAQLPIPSNNRLLPSASHFHHGASGSSSSGIYNIRKPDMSLLSHSRIE
AITEDIDDDMSENLIQSPLNNMKAVVSPNSKRVSLQHLDSSETTPWRRNGGRKLILSIPTFPSLTPHH*

DNA
ATGGATACACCGCAAAAGAGTATAACCCAGATCGGGACTCCAGTTTCTAAACTCAAAGCCGAGGATTCACCAGTGTTCAA
TTATATATGCAGTCTTTCTCCAATTAAGAGTACTAAATCAATCCCTATCACTCATACCTTAAGCTCTCTCAATTTCACAT
CTCCACCTTCTGTTTTCACTTCTCCTCATGCTGTTTCTCACAAAGAGTCTCGTTTCAGAAGTCAAGTTAACTCCTCTGAT
CATTCCAAAGATGGGGTTGGTTCTAATGAAGAAGCTGGTTCCATTGGAGAAAAAGGAAAGGAAGAAGCTTTAACCGAAAT
TGAACAGTCACAAATTCCTAAGAATGAGTGTAATACGCCCAGAGTTGCCAATGATGTGAGAGACAATGGTTGTTGTGAAG
ATGGTGGAATGAATCTGGTTAAGATGTGTGACAATGTCAAGCCAAAGAGTGATACTCCGGATTGGGGTACTCTGATTTCT
GCTACAACAGAACTTATTTATAACTTAACGAGTGAGTCAGAGGCTTATAGTTGCTTGTTGAAGAGAACATCCAACTCTGG
TGAACATGTACGTGGTGGTACAATGTCAACATTGGAGTCTGTTTCAAAGACCAATGTAGCCAACAATGAAAATGAGTCCT
TTGATGATCTTTCGATCTCGCACCGTGGTGTGAGAAGACGTTGTCTGGACTTCGAGATTCCAAGGAATAGTCAGCAAACA
TTGGGTGAATCTTCATCAAGTTGTGTAGTACCTAGCATTGGTCTGCATCTTAATGCCATACCAATGTCATCTAAGGACAA
CAATGTTGTTAATGAGTACTCATTTTCCGGTAACATCAAAGTCGGTTCGCAAAGTTTTACCACTTCGGATCTTCACTCGA
AGCACCACATTGTGAGAGAAAACGAAATCGGGAAAGATGCAGGTCAAGCTTTAGAAGAGTTTCCAAAGTCTTCAGCTTTA
GAAGGGTTGCCAATAAGCCCCAAGAAGAAAAGGCGAAAGTCCGAACAATCAGGAGAAGGCGAGTCGTCATGTAAACGGTG
CAACTGCAAAAAATCCAAGTGTTTGAAGCTTTACTGTGAATGCTTTGCTGCTGGAGTTTATTGCATAGAGCCATGTTCAT
GTATAGATTGCTTCAATAAATCTATCCATGAAGACGTTGTTTTGGCTACTCGCAAACAGATTGAATCCCGCAATCCACTT
GCATTTGCTCCTAAAGTCATAAGAAGCTCAGATTCCATCATTGAAGTTGGTGATGATACAAGTAAAACTCCTGCTTCAGC
GCGACACAAACGAGGCTGTAACTGCAAGAAATCAAACTGTCTGAAGAAATACTGTGAATGCTATCAGGGTGGAGTTGGCT
GTTCCATAAACTGTAGATGTGAAGGATGCAAAAATGCATTTGGCAGGAAAGATGGATCTTTGTTCGAACAAGATGAGGAA
AACGAAGTTTCTGGCAAAATTGTAACAACGAAAACACAATCAAATGTCGAGTTATTCAATCCTCTACCTTCAACACCAAT
GCCATTAAGACAACCACTGGCTCAACTTCCCATCCCATCCAACAATAGACTGCTTCCTTCAGCATCTCATTTTCATCACG
GAGCTTCAGGATCATCGTCCTCGGGAATATACAACATCAGAAAACCAGACATGAGTTTGCTGTCTCATTCAAGGATCGAG
GCAATCACAGAAGATATTGATGATGATATGTCTGAGAACCTAATCCAATCTCCATTAAATAACATGAAAGCTGTAGTGTC
TCCCAACAGCAAAAGGGTTTCTTTGCAGCATCTTGATTCATCAGAGACGACTCCATGGAGAAGAAATGGTGGCAGGAAAC
TGATACTTTCGATCCCAACGTTTCCTTCTCTCACCCCACACCATTAG