Details for Capsella Locus Carubv10015866m

Position : scaf_3 ( 5`- 13555124 .. 13555621 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015866m

Protein [Map View]
MLSSSSTLLIPPFLSSSSSSPSRPLSAISPPSSSRVSRISPSLSATTASSSYTCADDRLRRRFSATASLYEILEIPAGST
SKEIKSAYRRLARICHPDVAGNGRNNNNSSADDFMKIHAAYCTLSDPEKRAVYDRRILGRTRPLTVGVSGFAGYAGRNWE
TDQCW*

DNA
ATGCTCTCTTCTTCTTCAACCTTGTTAATTCCTCCATTCCTCTCTTCTTCTTCTTCTTCTCCTTCTCGGCCACTCTCTGC
AATTTCACCACCGTCGTCGTCACGCGTTTCCCGGATCTCGCCGTCTCTTTCCGCAACCACCGCATCATCATCCTACACTT
GCGCAGACGATCGATTACGCCGACGTTTTTCAGCGACCGCGTCTCTCTACGAGATCCTCGAAATCCCCGCCGGCTCGACG
AGTAAAGAGATCAAATCGGCTTACCGGCGACTAGCTCGGATCTGCCATCCCGATGTGGCGGGTAATGGTCGGAACAATAA
TAACTCGTCGGCGGACGATTTCATGAAGATCCACGCCGCGTATTGTACGCTCTCGGATCCTGAGAAACGCGCCGTTTATG
ATCGGAGGATACTTGGTCGGACCCGGCCGTTAACCGTCGGTGTTTCTGGATTCGCCGGTTACGCCGGACGGAATTGGGAA
ACCGATCAGTGTTGGTAA