Details for Capsella Locus Carubv10015858m

Position : scaf_3 ( 5`- 8236791 .. 8238763 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015858m

Protein [Map View]
MTMTKKLIITLLLLISIAFVHCLAFHVEFEEFEPPQQEEQDVPRRILAVVLAVVPGAAQARDGRKSQRPRFLTSFKNWFQ
SNEGFVKILPKFTKRAPNLFRGIGNYRFALFEMEPNTFLVPHHLDADFVVIILQGQGVVEYVTDKTKESFQVTKGDVVRL
PSGVTHFATNTNQTVPLRFAKIMVPVNNPGQFKDYFPARSQFQQSYFTGFSKEVLSASFNIPEELVGRVFFGSQQMGQGI
MRRISPDQIKELTEGATSPSNKHKEKKSKHKDTNTKWNPFNIFKHDSVETYTNDFGHFHEAHPESFDQLQDLHISVAWVN
MKQGSLFLPHYNSRTTFVTFVENGCARYEMASPYTSQGEKQQQQQLWPEQGGEEQEEDMSGQVHKIVSRVCKGDVFIIPA
GHPVTLVSHDENFVSVGFGIHASNCTRTFLAGEENMLSNLDTVATKVTFSVGSKMAEKLFTSQNYSYFAPTTRSHQQTQE
KREPSFQSIFSFAGF*

DNA
ATGACAATGACCAAGAAACTAATCATAACACTTCTCCTTCTCATCTCCATAGCTTTCGTCCATTGCTTGGCCTTCCATGT
GGAGTTTGAAGAGTTCGAACCACCGCAGCAAGAGGAACAAGATGTTCCTCGCCGTATCCTCGCCGTAGTCCTGGCCGTCG
TCCCGGGGGCGGCTCAGGCGAGGGATGGGAGGAAGAGTCAACGACCTCGTTTCCTTACCAGTTTCAAGAATTGGTTCCAA
TCAAATGAAGGGTTCGTGAAAATATTGCCTAAGTTCACAAAACGCGCACCAAATCTCTTCCGTGGGATTGGAAACTACAG
ATTCGCGTTGTTTGAGATGGAGCCAAACACTTTCCTTGTGCCTCACCATTTGGATGCTGATTTCGTGGTGATAATACTAC
AAGGCCAAGGAGTGGTTGAGTATGTGACGGACAAAACAAAAGAATCGTTCCAAGTAACCAAAGGTGATGTGGTGAGACTC
CCTTCCGGCGTCACCCACTTTGCCACCAACACTAACCAGACCGTTCCTCTTCGTTTCGCGAAGATCATGGTCCCCGTCAA
CAATCCTGGCCAGTTCAAGGATTACTTCCCTGCTCGATCCCAGTTTCAACAATCCTACTTCACAGGGTTTAGCAAAGAAG
TCCTCTCTGCGAGTTTCAACATACCGGAAGAGTTGGTAGGGAGAGTATTTTTTGGCTCACAACAAATGGGACAAGGGATT
ATGCGGAGAATTTCACCAGACCAGATCAAAGAACTTACCGAAGGCGCTACTTCTCCTTCAAACAAACACAAAGAAAAAAA
GTCCAAGCACAAAGACACGAACACGAAGTGGAACCCTTTCAATATCTTTAAACACGATTCAGTTGAAACATACACCAACG
ACTTTGGTCATTTCCACGAGGCACATCCTGAGAGTTTTGATCAACTACAAGACCTTCACATTTCCGTCGCTTGGGTCAAC
ATGAAACAGGGTTCCTTGTTCCTTCCTCACTATAACTCTAGGACAACTTTTGTTACCTTCGTGGAGAATGGTTGTGCTCG
CTATGAGATGGCTTCTCCGTATACATCCCAAGGAGAGAAGCAACAACAACAACAATTGTGGCCTGAACAAGGAGGGGAAG
AACAAGAAGAAGATATGAGTGGACAAGTACACAAGATTGTCTCAAGAGTGTGCAAAGGCGACGTCTTTATCATTCCGGCA
GGTCATCCAGTCACTTTAGTCTCACACGACGAGAACTTTGTCTCAGTAGGGTTTGGTATCCATGCATCCAACTGCACAAG
AACGTTCCTTGCAGGGGAAGAGAATATGTTGAGCAACCTTGACACTGTGGCGACTAAAGTCACGTTCAGTGTAGGAAGTA
AAATGGCGGAGAAACTGTTCACGAGCCAAAACTATTCATACTTTGCACCTACGACTCGTAGCCATCAACAAACCCAAGAA
AAACGTGAGCCATCGTTCCAATCAATCTTCAGCTTCGCCGGTTTTTGA