Details for Capsella Locus Carubv10015856m

Position : scaf_3 ( 5`- 3055347 .. 3057671 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015856m

Protein [Map View]
MRGGGRRRSNGGGGGSGKSKSKSPGQSTRTNFNSPAGSSSGGRRRRQNNTTLFVEGGILSDYRRDADFSTPSRGGSSSRK
GSNLRSTDRVNASASTSGPRKCSGNAFVYQYPPVEFEEGLDRRSGVEVDQMDDSNPIVLGKSEGTQIVAFLDQTPSSSKG
TKVNYDYLYEPSFVLGDESHRGLGFCDDSDAGPSGSLSIPKASEDQGGSFSHEEEVDTGANEDEVMPDVVKTPKRNLGFI
SIGGMKLYTEDISGEESDGEEGSNDDDDSGDEGSTGSSESSQSDSSEDMFGSNSEIDDAVAKDYLEGIGGSEIMLDAHWL
AEQSLDKLDLSSSDSSSSDSSDRKTRKLTGIGLQKASMEYGKKTTTRSRFSGQGKSTHPFTMDDLMFVKDPRSLSGKKNK
KKEVAKFPQSWPSGTQKSKKSRNFPGEKKKHRKEYIAVKRRERMLQRGVDLTDINSQLESFVLENVDMHCFQCMHNRDCS
QVRRLADVYRLSSSCSGSGKKSFVTVTRTYQTCMPSASDKLRIAKLIGAGYEDDDFAVGGGVKGKSGSLDRKKAKDSAKK
RTTREERERNQSNGKKSSYADQPVSFVSSGVIDSEIAVANTSGAKDAKQVAETTPGTSNGADIGAFEVHTRGFGSKMMAK
MGFIDGGGLGKDGKGISQPIEAVQRPKSLGLGLDFSIDTEDTSPSSNNNAKRNRSSSSGKHAKHISHDNGASSSGRIRDK
RLGAFEQHTTGFGSRMMARMGFVEGSGLGRESQGIVNPLVAVRRPRVRGIGAEG*

DNA
ATGCGAGGCGGTGGTAGGAGAAGATCGAACGGTGGTGGTGGTGGTTCTGGAAAAAGCAAATCTAAATCTCCGGGACAGAG
CACGAGAACCAATTTTAATTCCCCGGCGGGGTCTTCCTCAGGCGGTCGTCGCCGACGTCAGAATAATACTACTCTGTTTG
TAGAAGGAGGCATTCTCTCCGATTACCGAAGAGATGCTGATTTTTCGACGCCATCTCGAGGAGGAAGCTCGTCGAGAAAG
GGGTCGAATCTTAGAAGCACAGATCGTGTGAATGCTTCTGCTTCCACCAGTGGTCCAAGGAAATGCAGTGGTAATGCTTT
TGTGTATCAGTATCCTCCTGTCGAATTTGAGGAAGGGTTGGACCGAAGATCAGGCGTAGAAGTTGATCAGATGGATGATT
CAAATCCTATAGTGTTGGGGAAGTCAGAGGGGACTCAGATTGTTGCATTTCTGGATCAGACGCCTTCTTCTTCGAAAGGG
ACTAAGGTAAATTATGATTACCTATACGAACCGAGTTTTGTTTTAGGTGATGAGTCTCATAGAGGGTTGGGATTTTGTGA
TGATTCTGATGCTGGACCAAGTGGTAGCCTTTCTATTCCAAAGGCATCGGAAGATCAAGGTGGTTCATTTTCCCATGAGG
AGGAGGTTGATACTGGTGCAAATGAAGATGAAGTGATGCCTGACGTTGTGAAAACACCTAAAAGGAATTTGGGTTTCATT
TCTATTGGAGGGATGAAATTATACACTGAAGATATATCTGGTGAAGAGAGTGATGGAGAAGAAGGGTCCAATGATGATGA
TGATTCTGGAGATGAAGGCAGCACTGGCTCTTCTGAATCATCTCAGAGTGACAGCTCGGAAGACATGTTTGGAAGTAATT
CCGAGATTGATGATGCTGTTGCAAAGGATTACTTGGAAGGTATTGGTGGCAGTGAGATTATGTTGGATGCTCATTGGTTG
GCTGAACAATCATTGGATAAATTGGATTTGTCAAGTTCTGATAGTTCTTCAAGTGATTCTTCTGATCGAAAGACAAGAAA
GTTGACGGGTATTGGTCTGCAAAAAGCTTCGATGGAATATGGTAAGAAGACGACGACAAGAAGCCGTTTCTCGGGGCAGG
GTAAGTCTACTCATCCATTTACAATGGATGATCTTATGTTTGTGAAAGATCCAAGAAGTCTTTCGGGGAAGAAGAATAAG
AAGAAAGAGGTGGCTAAGTTTCCCCAGTCTTGGCCTTCAGGGACACAAAAGAGCAAGAAGTCCCGTAATTTTCCTGGTGA
GAAGAAGAAACACCGCAAAGAATACATTGCTGTGAAGCGCCGTGAGAGAATGTTGCAGCGTGGTGTTGACCTTACTGATA
TTAACTCTCAATTAGAGAGTTTTGTTCTGGAAAATGTGGACATGCACTGTTTCCAGTGTATGCATAATCGAGATTGCTCT
CAGGTAAGACGATTAGCAGATGTATACCGCTTATCAAGTAGTTGCAGTGGTTCTGGAAAGAAAAGCTTCGTGACAGTGAC
TCGAACATATCAGACATGTATGCCATCTGCCAGCGATAAACTTCGCATCGCGAAGCTAATAGGAGCAGGATATGAGGATG
ATGATTTTGCTGTCGGTGGAGGGGTAAAAGGGAAATCTGGAAGTTTAGATAGGAAGAAAGCAAAAGACTCAGCCAAAAAG
CGAACTACTAGAGAGGAACGGGAGAGAAACCAAAGCAACGGGAAGAAGAGTTCATATGCTGATCAACCTGTATCATTTGT
GTCAAGTGGCGTAATCGATTCTGAGATAGCTGTTGCAAATACCTCTGGTGCAAAAGATGCAAAACAGGTAGCTGAAACTA
CTCCGGGAACCTCTAATGGAGCAGACATTGGAGCATTCGAGGTACACACCAGAGGCTTTGGATCCAAAATGATGGCGAAA
ATGGGATTCATAGATGGAGGTGGTCTAGGAAAGGATGGTAAGGGGATTTCACAGCCAATAGAAGCTGTTCAACGTCCAAA
ATCTCTTGGCTTAGGTTTGGATTTCTCTATTGACACTGAAGACACGAGTCCGTCAAGTAATAACAACGCAAAACGGAACA
GATCTTCTTCCTCTGGCAAACATGCAAAACACATTTCCCATGACAATGGTGCCTCTAGTTCCGGAAGAATTAGAGACAAA
AGATTAGGAGCCTTTGAGCAGCACACAACTGGTTTTGGGTCGAGGATGATGGCGAGAATGGGTTTTGTCGAAGGCTCGGG
TTTGGGAAGAGAGTCACAAGGCATAGTCAATCCGCTGGTCGCCGTCAGACGTCCCAGAGTACGTGGAATAGGCGCTGAAG
GCTAA