Details for Capsella Locus Carubv10015849m

Position : scaf_3 ( 5`- 786419 .. 786928 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015849m

Protein [Map View]
MGNYASCALNKTTPSSHSSSPSAKVILPDGGVRDIHAPTKAAELMMEMPSYFLVDAKFLKIGRKFIPLAADDDLDLGGCH
VYVVFQMMRVTSAANASDMARLYQAGKKRAKSVDNRRVSPEEEGDDVRLIGPKLNLEDIEEFSAAEFIHRISVSKSKKPQ
LETIAEEVP*

DNA
ATGGGGAACTACGCTTCATGCGCTCTCAACAAAACGACACCGTCGTCACACTCGTCATCACCGTCGGCCAAAGTGATTCT
CCCGGATGGTGGGGTGCGTGATATCCACGCGCCAACCAAGGCAGCCGAGCTCATGATGGAGATGCCAAGCTATTTCCTGG
TCGACGCCAAATTCTTGAAAATCGGCCGGAAATTTATCCCACTCGCCGCCGACGACGACCTCGACCTCGGAGGCTGCCAT
GTGTACGTCGTTTTCCAGATGATGCGTGTCACTTCCGCAGCCAACGCCTCCGACATGGCTCGGCTCTACCAAGCCGGCAA
GAAACGCGCCAAAAGCGTTGACAATAGGAGAGTGTCTCCGGAAGAGGAAGGTGATGACGTAAGGCTGATCGGGCCGAAGC
TGAATCTTGAAGACATAGAAGAGTTCTCGGCGGCGGAGTTTATTCATCGTATCTCTGTTTCCAAATCTAAGAAACCACAG
TTGGAGACCATCGCTGAAGAAGTGCCCTAA