Details for Capsella Locus Carubv10015839m

Position : scaf_3 ( 5`- 1629027 .. 1631822 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015839m

Protein [Map View]
MADEEDELPEETELSYDQKKEIAKWFLLNAPAGEINYVAKDLKAVLSDEEVYNEAAMEAFPVYNKSHMICLEMPTGAGDV
IISSYSEITENEYLDPRTAQVAIVDHVKQICTKVRPANDEELPSLYIEEYRYALDAEIQRYVSESYPKGMSAVNCVKGKD
TEGPGSNFEFVVIITAMRLSPQNFCNGSWRSVWNIDFQDESQVLDIKGKLQVGAHYFEEGNVELDAKKDFQDSTIFQSAD
DCAIAIANIIRHHETEYLAALEVAYSKLPDNTFKDLRRKLPVTRTLFPWQNTLQFSLTREVEKELGLGKWKMKKISVAGN
RTRVSWVKARYPNRWTTTDMMLE*

DNA
ATGGCGGATGAAGAAGACGAGTTACCGGAGGAGACAGAACTAAGTTACGACCAGAAGAAGGAAATCGCCAAGTGGTTTCT
CCTTAATGCTCCCGCTGGAGAAATCAATTACGTTGCCAAAGATTTAAAGGCGGTATTGAGCGACGAGGAAGTCTATAACG
AAGCAGCCATGGAAGCATTCCCAGTCTACAACAAGTCTCATATGATTTGCCTTGAAATGCCCACTGGGGCTGGTGATGTG
ATAATTTCATCTTACAGTGAAATTACTGAAAATGAGTACCTTGATCCAAGAACTGCCCAGGTTGCCATAGTTGATCATGT
CAAACAGATTTGTACAAAGGTACGGCCTGCAAATGATGAAGAACTTCCGTCTTTGTATATTGAGGAGTACAGATATGCTC
TTGATGCTGAAATCCAGAGATATGTTAGTGAATCTTATCCGAAAGGTATGTCTGCGGTTAATTGTGTGAAAGGGAAAGAT
ACAGAGGGTCCAGGATCCAACTTTGAGTTTGTTGTTATAATTACTGCCATGAGACTGAGTCCCCAGAACTTCTGTAATGG
AAGTTGGAGATCTGTATGGAACATCGACTTCCAGGATGAATCCCAAGTGCTTGACATAAAAGGGAAATTACAGGTAGGAG
CTCATTATTTTGAAGAGGGCAATGTGGAGTTAGATGCAAAAAAAGATTTCCAAGATTCAACAATATTTCAGTCTGCGGAT
GACTGCGCGATTGCCATTGCCAATATTATCAGGCACCATGAAACAGAGTACCTTGCAGCTCTAGAGGTAGCTTATTCTAA
ATTACCGGATAACACTTTCAAGGATTTGAGGAGGAAACTTCCGGTGACACGAACACTGTTCCCATGGCAGAACACTTTAC
AGTTCAGCCTAACAAGAGAGGTCGAGAAAGAACTTGGACTTGGCAAGTGGAAAATGAAAAAAATCTCCGTTGCCGGGAAT
CGAACCCGGGTCTCCTGGGTGAAAGCCAGATATCCTAACCGCTGGACGACAACGGATATGATGTTAGAATAG