Details for Capsella Locus Carubv10015813m

Position : scaf_3 ( 5`- 13548457 .. 13549041 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015813m

Protein [Map View]
MFDLGKAGCKIVAAVRRVDRLKSLCSEINSFNPRGIQAAALELDVSSDAATIQKAVKEAWEIFGKIDALINNAGFRGNVR
SSLDLSEDEWDKVFKTNLTGTWLVSKYICVLMRDAKHGGSVINISSVSGLHRGLVPGGIAYACSKGGVDTMTRMMALELG
VYKIRVNSIAPGLLKSEITHGLMEKEWLKTVTERT

DNA
ATGTTTGATCTAGGTAAAGCTGGCTGTAAGATTGTTGCAGCAGTTCGTCGTGTGGATCGTCTCAAATCACTCTGCTCTGA
AATCAACAGTTTCAATCCACGCGGAATCCAAGCTGCAGCTCTTGAGCTAGACGTTTCATCAGACGCAGCCACCATTCAAA
AAGCTGTGAAGGAAGCTTGGGAGATCTTCGGAAAGATCGATGCGTTGATCAACAACGCCGGGTTTAGAGGCAATGTCAGG
TCGAGTTTGGATTTGTCAGAAGACGAGTGGGACAAAGTCTTCAAGACCAACTTAACCGGGACTTGGTTAGTCTCCAAATA
CATATGCGTTTTAATGCGTGACGCTAAACATGGTGGTTCGGTTATAAACATATCATCAGTCTCTGGACTACACCGCGGTC
TTGTGCCTGGTGGAATCGCGTATGCATGTTCTAAAGGTGGTGTTGACACCATGACAAGGATGATGGCTCTTGAGTTAGGT
GTTTACAAGATCAGAGTGAACTCCATTGCACCGGGGCTTTTGAAGTCAGAGATCACACATGGTCTTATGGAGAAAGAGTG
GCTCAAGACCGTTACCGAACGGACT