Details for Capsella Locus Carubv10015789m

Position : scaf_3 ( 5`- 5929066 .. 5930914 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015789m

Protein [Map View]
MGWNTGFERIKQERKDLGFFKIFQSADLSSESMRAFPYNFMSRIPEKDLSYKMVIRAQWGKSWDVEVSKNTRYYYIEKPG
WDQFVSDNALGRNEFVTFIHKGKMIFNVYIYEQNCMEILIPRILMPMDCSGGIKREEEECSYKDVKKEYEETDESPERVE
IKIRKKISEESKTSKKKKTSKRVKNGMERGGSSRGVELKARQKKAEAYNTSKKMKKKIKRNKKMTGAPEFKITIRNSYLK
FLAIPKHFVDDHLPQKSKFFTIHHPDGLKSWKVLCLVREIRTIFSGGYSKLAREYPLLVGDKCTFKLIEPYAFILDISKK
TREEITHCMID*

DNA
ATGGGTTGGAACACTGGTTTTGAACGGATTAAACAAGAACGCAAGGACTTGGGTTTCTTCAAGATTTTTCAGAGTGCAGA
TTTGTCCTCTGAGAGCATGAGAGCGTTTCCATACAACTTCATGAGCAGGATCCCTGAGAAAGACTTATCTTACAAGATGG
TGATAAGAGCGCAATGGGGAAAGTCTTGGGATGTAGAAGTCTCCAAGAATACGAGATATTACTACATCGAGAAGCCTGGA
TGGGATCAGTTTGTGAGTGACAACGCTTTGGGAAGAAACGAGTTTGTCACTTTCATTCACAAAGGGAAGATGATCTTTAA
TGTCTACATCTACGAGCAGAATTGCATGGAGATCCTAATACCTCGAATACTCATGCCTATGGATTGTTCTGGTGGGATCA
AGAGAGAAGAAGAAGAGTGCAGCTACAAAGATGTGAAGAAAGAATATGAGGAAACAGATGAATCTCCTGAACGAGTTGAG
ATCAAAATTAGAAAGAAGATATCTGAAGAGAGCAAAACATCTAAGAAGAAGAAGACGAGCAAGAGAGTGAAGAATGGTAT
GGAAAGAGGTGGATCTTCGAGAGGGGTTGAGCTCAAAGCTAGGCAGAAGAAAGCTGAGGCTTACAATACATCAAAGAAGA
TGAAGAAGAAGATCAAGAGAAATAAGAAAATGACTGGTGCTCCAGAATTCAAAATCACCATAAGGAATTCATACCTCAAG
TTCCTGGCAATCCCAAAACATTTTGTGGATGATCATCTTCCGCAGAAGTCTAAGTTCTTCACTATTCACCACCCGGATGG
TCTCAAGTCATGGAAGGTGCTTTGTTTGGTGAGGGAGATTCGGACAATCTTCTCAGGTGGATACTCGAAACTGGCAAGGG
AGTATCCTTTATTGGTTGGTGACAAATGCACCTTCAAGCTTATTGAACCCTATGCGTTTATCCTAGATATCTCCAAGAAA
ACTAGAGAGGAGATCACTCACTGCATGATCGATTGA