Details for Capsella Locus Carubv10015752m

Position : scaf_3 ( 5`- 2735510 .. 2743570 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015752m

Protein [Map View]
MALGDLMVSRFSQSSVSLVSNHRYDDDCVSSHDDGDSRRKDSEAKSSSYGNGTTERAATATSMAYLPQTIVLCELRHDAS
EASSPLGTSEIILVPKWRLKERMKTGCVALVLCLNITVDPPDVIKISPCARIEAWIDPFSMAPPKALETIGKNLSTQYER
WQPRARYKVQLDPTVDEVRKLCLTCRKYAKTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPISELDSWLKTPSIY
VFDCSAARMILNAFAELHDWGSSGSSGSSRDCILLAACDVHETLPQSVEFPADVFTSCLTTPIKMALKWFCRRSLLKEII
DESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIAWNVLPHELFQRLFRQDLLVASLFRNFLLAERIMRSANCNPISHPML
PPTHQHHMWDAWDMAAEICLSHLPQLVLDPSAEFQPSPFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRFRA
LVLLGRFLDMGSWAVDLALSVGIFPYVLKLLQTTTNELRQILVFIWTKILALDKSCQIDLVKDGGHIYFIRFLDSSGAFP
EQRAMAAFVLAVIVDGHRRGQEACLEANLIGVCLGHLEASRPSDPQPEPLFLQWLCLCLGKLWEDFMEAQIMGREANAFE
KLAPLLSEPQPEVRAAAVFALGTLLDIGFDSNKSVVEDEFDDDEKIRAEDAIIKSLLDVVSDGSPLVRAEVAVALARFAF
GHKQHLKLAAASYWKPQSSSLLTSLPSIAKFHDPGSATIVSLHMSPLTRASTDSQPVAREARISSSPLGSSGLMHGSPLS
DDSSLHSDSGMMHDNVSNGAVHQSRLLDNAVYSQCVRAMFALAKDPSPRIASLGRRVLSIIGIEQVVAKPSKPTGRPGEA
ATTSHTPLAGLARSSSWFDMHAGNLPLSFRTPPVSPPRTNYLSGLRRVCSLEFRPHLLGSPDSGLADPLLGVSGSERSLL
PLSTIYSWSCGHFSKPLLGGADASQEIAAKREEKEKFALEHIAKCQHSSISKLNNNPIANWDTRFETGTKTALLHPFSPI
VIAADENERIRVWNYEEATLLNGFDNHDFPDKGISKLCLINELDDSLLLVASCDGSVRIWKNYATKGKQKLVTGFSSIQG
QKPGARDLNAVLDWQQQSGYLYASGEVSTVTLWDLEKEQLVRSIPSESECGVTALSASQVHGGQLAAGFADGSLRLYDVR
SPEPLICATRPHQKVERVVGLSFQPGLDLAKVVSASQAGDIQFLDLRTTRDTYLTIDAHRGSLTALAVHRHAPIIASGSA
KQLIKVFSLQGEQLGIIRYYPSFMAQKIGSVSCLTFHPYQVLLAAGAADSFVSIYTHDNSQAR*

DNA
ATGGCATTAGGAGACTTAATGGTGTCTCGGTTCTCGCAATCTTCTGTTTCTTTGGTCTCCAATCACCGTTACGACGACGA
CTGTGTCTCTAGTCACGATGACGGTGATTCACGGAGGAAGGATTCTGAGGCTAAGAGCAGTAGCTACGGGAATGGTACAA
CGGAGAGAGCCGCCACCGCCACCAGCATGGCATACTTGCCTCAGACTATTGTGCTCTGCGAGCTTCGACACGATGCTTCC
GAGGCCTCTTCGCCCTTGGGGACTTCTGAAATTATATTGGTCCCCAAATGGCGGCTTAAAGAACGAATGAAAACCGGATG
TGTAGCTTTAGTTCTGTGTTTAAACATTACTGTTGATCCGCCGGATGTTATAAAGATATCTCCATGTGCTAGAATCGAGG
CCTGGATAGATCCATTTTCCATGGCCCCTCCTAAAGCTCTTGAGACAATTGGAAAGAACTTGAGCACTCAGTATGAGAGA
TGGCAACCAAGGGCCCGGTATAAGGTTCAACTAGATCCGACGGTAGATGAGGTGAGGAAGTTGTGCTTGACTTGTCGGAA
ATATGCAAAGACCGAGAGAGTTCTATTCCATTATAACGGGCATGGTGTGCCAAAGCCTACAGCTAATGGTGAAATTTGGG
TTTTCAACAAGAGTTATACACAGTACATTCCCTTGCCAATCAGTGAGCTTGATTCCTGGTTGAAGACACCCTCCATCTAC
GTTTTCGACTGCTCTGCTGCTAGGATGATTCTTAATGCCTTTGCTGAGCTTCATGATTGGGGTTCTTCTGGGTCCTCTGG
ATCCTCAAGGGACTGCATTCTACTTGCTGCTTGTGATGTACATGAGACACTTCCACAGAGCGTTGAATTTCCAGCTGATG
TTTTTACATCTTGCCTCACGACACCTATTAAAATGGCGTTGAAATGGTTCTGCAGGCGTTCTCTTCTGAAAGAAATCATC
GATGAATCACTTATTGACAGGATTCCAGGCCGGCAAAATGACCGTAAGACATTGTTAGGGGAGTTGAACTGGATTTTCAC
AGCAGTGACGGATACAATTGCGTGGAATGTGCTTCCTCATGAACTTTTCCAGAGATTATTCAGACAGGACTTGTTGGTCG
CTAGCCTTTTCCGAAATTTCTTACTTGCTGAGAGAATAATGCGGTCTGCAAACTGTAATCCAATATCTCACCCTATGCTG
CCTCCTACGCATCAACATCATATGTGGGATGCATGGGACATGGCTGCTGAAATCTGTCTTTCTCACCTTCCCCAACTTGT
TCTGGACCCTAGCGCAGAGTTCCAGCCAAGTCCCTTTTTTACTGAGCAACTGACAGCTTTTGAGGTGTGGCTTGATCATG
GATCTGAGCATAAGAAGCCACCTGAGCAGTTGCCTATTGTCCTACAGGTGTTACTTAGCCAGTGCCATCGGTTTCGTGCT
CTTGTTCTTCTTGGAAGATTTCTTGATATGGGTTCATGGGCTGTGGATCTGGCCTTGTCTGTTGGAATATTCCCATATGT
GCTGAAGCTTCTGCAAACAACAACGAATGAGCTAAGACAAATTCTGGTTTTCATATGGACAAAAATTCTTGCACTTGATA
AGTCATGTCAAATTGATCTTGTGAAGGACGGGGGGCATATATATTTCATACGATTTCTAGATAGCTCTGGTGCATTTCCA
GAACAACGAGCTATGGCTGCTTTTGTTCTTGCTGTCATTGTTGATGGACATCGACGAGGCCAGGAAGCATGTCTTGAAGC
TAATTTAATTGGTGTTTGTCTGGGGCACCTTGAAGCATCCAGACCAAGTGATCCACAGCCAGAACCGTTGTTTCTACAAT
GGCTTTGTCTTTGTCTTGGAAAGTTGTGGGAAGATTTCATGGAGGCCCAAATAATGGGCAGGGAGGCAAATGCTTTTGAA
AAGTTGGCACCTCTGCTTTCCGAGCCTCAACCTGAGGTAAGGGCTGCTGCTGTTTTTGCCCTGGGTACCTTACTTGATAT
TGGGTTTGACTCTAATAAAAGTGTGGTGGAGGATGAATTTGATGATGATGAAAAGATTAGAGCCGAAGACGCTATCATTA
AAAGTCTTTTAGATGTAGTTTCAGATGGGAGTCCACTTGTCCGAGCAGAGGTTGCCGTAGCTCTTGCACGTTTTGCCTTT
GGCCACAAACAGCACCTAAAATTAGCTGCAGCTTCATATTGGAAGCCTCAGTCAAGTTCTTTGCTTACTTCTCTTCCTTC
AATAGCTAAATTCCATGATCCTGGGAGTGCAACAATTGTTTCTTTACACATGAGTCCTCTGACTAGAGCTAGCACTGATA
GCCAACCAGTGGCTCGTGAGGCTAGGATCTCAAGCAGCCCTCTTGGCTCTTCTGGGCTGATGCATGGATCTCCATTATCT
GATGATTCTTCGTTACATTCTGACTCTGGAATGATGCATGACAATGTCAGCAATGGAGCTGTCCATCAGTCTAGACTGTT
GGATAACGCTGTTTATTCGCAGTGCGTTCGAGCTATGTTTGCATTAGCTAAAGATCCTTCTCCACGTATTGCGAGTCTTG
GACGGCGTGTGCTTTCTATTATTGGAATCGAACAGGTTGTTGCGAAACCATCGAAGCCCACTGGCCGACCAGGGGAAGCT
GCAACTACATCTCACACTCCTCTTGCTGGCTTAGCCCGTTCATCCTCGTGGTTTGATATGCATGCAGGTAATTTGCCCCT
AAGTTTTAGGACTCCCCCAGTCAGCCCTCCTCGAACAAACTATTTGAGTGGGCTGAGGAGAGTTTGTTCGTTAGAGTTCA
GGCCTCATCTGTTGGGTTCACCCGACTCAGGTTTGGCTGATCCGCTTTTAGGCGTCAGTGGATCTGAACGGAGTTTGCTT
CCACTATCAACTATCTACAGCTGGAGTTGTGGCCACTTTTCTAAACCACTTCTTGGTGGTGCCGATGCTAGTCAAGAAAT
TGCAGCCAAAAGAGAAGAGAAAGAAAAATTTGCACTTGAGCATATTGCAAAATGCCAGCACTCTTCTATTAGCAAGCTCA
ACAATAATCCTATTGCGAACTGGGATACGAGGTTTGAAACGGGAACAAAGACGGCCCTCCTTCACCCATTCTCTCCTATT
GTAATTGCTGCAGACGAGAATGAGCGGATCAGAGTGTGGAACTATGAGGAAGCAACTCTTCTCAATGGCTTTGACAATCA
TGACTTTCCTGACAAAGGAATTTCAAAGCTCTGCCTCATCAATGAACTTGACGATTCTCTGCTACTTGTTGCGTCATGTG
ATGGGTCGGTCCGGATATGGAAAAATTATGCAACAAAGGGTAAACAAAAGCTTGTTACTGGGTTTTCTTCAATCCAGGGT
CAAAAGCCCGGTGCACGCGACTTGAACGCTGTCTTGGACTGGCAACAACAGTCTGGTTACCTGTATGCTTCTGGGGAGGT
GTCAACAGTCACACTTTGGGACCTTGAGAAAGAACAGCTTGTCAGATCTATTCCCTCTGAATCAGAGTGTGGAGTTACAG
CACTTTCCGCTTCTCAAGTGCATGGAGGTCAGCTTGCTGCTGGTTTTGCTGATGGATCTTTGAGACTATATGATGTTCGG
TCACCTGAACCGCTTATCTGCGCAACTCGGCCTCATCAGAAAGTTGAAAGGGTGGTTGGACTCAGTTTTCAGCCTGGACT
TGATCTCGCAAAGGTGGTGAGTGCATCGCAGGCTGGTGACATACAGTTTCTTGACCTTAGAACAACAAGGGACACGTACC
TGACAATTGATGCACACAGGGGTTCACTCACGGCCTTAGCTGTTCACAGACACGCTCCAATCATCGCGAGTGGATCTGCG
AAACAGCTCATTAAAGTGTTCAGCCTTCAAGGGGAACAACTAGGGATAATCCGCTACTACCCGTCCTTCATGGCACAGAA
GATTGGTTCAGTGAGTTGCCTAACATTTCATCCATATCAGGTTCTGCTAGCAGCTGGAGCTGCTGACTCATTTGTCTCTA
TATACACCCACGACAACTCGCAAGCAAGATGA