Details for Capsella Locus Carubv10015749m

Position : scaf_3 ( 5`- 5760023 .. 5760418 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015749m

Protein [Map View]
MRGLSVTTAAIFAILVILTVQYWSVAVSSQSVELSGDFPPFETECRGSIAECSVSAEGDLFSGGGGMGAEFEMDSEINRR
ILATRRYISYGALRRNTVPCSRRGASYYNCRRGAQANPYRRGCSVITRCRR*

DNA
ATGAGAGGACTCTCCGTAACCACGGCGGCGATATTCGCGATTCTAGTCATTCTCACCGTCCAGTACTGGTCCGTCGCGGT
TTCTTCTCAGTCCGTCGAACTGTCCGGAGATTTCCCTCCGTTCGAGACAGAGTGCCGCGGTTCTATAGCAGAGTGCTCTG
TTTCCGCCGAGGGAGATCTATTCAGCGGAGGAGGAGGAATGGGAGCGGAGTTCGAGATGGACTCGGAGATCAACAGGCGG
ATATTAGCAACGAGGAGGTACATAAGCTACGGTGCGCTGAGGAGAAACACTGTTCCTTGCTCGCGTCGCGGCGCATCTTA
CTACAATTGCAGACGTGGAGCTCAGGCCAACCCTTACCGTCGTGGCTGCAGCGTCATCACTCGCTGCCGGCGCTGA