Details for Capsella Locus Carubv10015748m

Position : scaf_3 ( 5`- 2244502 .. 2244830 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015748m

Protein [Map View]
MNCKTRFMSSMVMISIIIIFLLVSGKTEALPQNCIGSCKMLIDCATACIKMGYTTGQCVGWKDPDICCCDH*

DNA
ATGAATTGCAAAACTAGATTCATGAGCTCTATGGTGATGATTTCAATAATCATCATATTTCTTTTGGTTTCAGGGAAAAC
TGAAGCGCTTCCCCAAAATTGCATTGGATCATGTAAAATGCTTATTGACTGTGCGACGGCTTGTATCAAGATGGGATACA
CAACTGGCCAGTGTGTTGGCTGGAAAGACCCCGATATATGTTGCTGCGACCATTGA