Details for Capsella Locus Carubv10015738m

Position : scaf_3 ( 5`- 6749294 .. 6751601 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015738m

Protein [Map View]
MAQMQREEAESVTKETTEKKYSDVGGGSSGAQATAFKFNAQAPEFVPRSHTTAPAPQVSPISGYFYPCFHYNGGCIGGCG
GGGTNVGTPSSDWIYVGGGDPTGQHQHVHDPAAAFYIPSPAVQFPANQTSSSSSSSKNLLSDDLRLKIVKQVEYQFTDMS
LLANESISKHISKDPEGYVPISYIASTKKIKALTSNHHLVSLSLRSSSKLVVSEDGKKVKRTSQFTDRDREELQGRTVVA
ENLPDDHSYQNLEKIFGVIGNVKAIRICHPPESNSSRPKGDFLMSNKIHALIEYDNTVIADKAVEKLNDERNWRKGLRVR
LLLRCSPKSVLKNRRNFDGILIDDELPSYESGEDSPRLHLTESQLDNDGDDNNVGGLWGKGRGKGRGRSPRSYAVGGGGR
SFGIGLGVSLGIPSLGSHESSSPKTATKGPRMPDGTRGFTMGRGKPSSISLSPNNL*

DNA
ATGGCGCAGATGCAGCGAGAAGAGGCAGAGTCCGTCACGAAAGAGACGACGGAGAAGAAATATTCAGACGTAGGCGGCGG
ATCTTCCGGCGCTCAGGCGACGGCGTTTAAATTCAACGCTCAGGCGCCGGAATTCGTACCGCGATCACATACCACCGCAC
CAGCACCACAGGTTTCTCCGATCTCCGGTTACTTTTACCCTTGCTTCCATTACAACGGCGGTTGCATTGGAGGATGCGGC
GGCGGAGGAACAAACGTTGGTACTCCATCGTCGGATTGGATCTACGTTGGAGGAGGAGATCCTACTGGTCAGCATCAACA
TGTTCATGATCCGGCGGCTGCGTTTTACATTCCGAGTCCGGCTGTTCAGTTTCCGGCTAATCAAACCTCTTCCTCTTCTT
CCTCTTCCAAGAATCTGCTTTCCGATGATCTCCGGCTTAAGATCGTCAAACAGGTTGAGTACCAGTTCACGGATATGAGT
CTCCTAGCCAACGAGTCCATTTCAAAGCACATAAGCAAAGACCCTGAAGGTTATGTGCCTATATCATATATTGCTTCGAC
TAAGAAGATCAAGGCTTTAACGAGTAACCACCACCTAGTTTCACTTTCCCTACGCTCTTCCTCAAAGCTTGTTGTGAGTG
AAGACGGCAAGAAAGTTAAGCGTACAAGTCAATTTACTGACAGAGACAGAGAGGAATTGCAGGGCCGGACTGTTGTAGCA
GAGAATTTGCCAGATGATCATTCTTACCAGAACCTTGAGAAGATTTTTGGAGTTATTGGAAATGTCAAAGCGATTCGTAT
ATGTCATCCTCCAGAGTCCAACTCCTCTCGTCCAAAAGGAGATTTCTTGATGAGCAACAAAATTCACGCGCTTATCGAGT
ATGACAACACTGTTATCGCGGATAAAGCTGTGGAGAAGCTGAACGATGAAAGAAACTGGAGGAAAGGGCTTCGTGTGAGG
CTGCTTCTTAGATGCTCTCCCAAATCAGTGCTCAAGAACCGAAGAAACTTCGATGGAATCCTCATTGATGATGAGCTCCC
TTCTTATGAATCAGGAGAAGACTCTCCACGTCTCCATTTAACCGAATCACAGCTTGATAACGATGGTGATGACAACAATG
TTGGTGGACTATGGGGTAAAGGGAGAGGAAAAGGAAGAGGACGATCCCCAAGAAGCTACGCAGTAGGAGGAGGAGGACGT
AGCTTCGGGATTGGGCTCGGAGTCAGCCTCGGGATACCGAGCCTAGGTTCACACGAATCTTCATCTCCTAAAACAGCAAC
AAAGGGACCAAGAATGCCTGATGGAACGAGAGGCTTCACCATGGGGCGAGGCAAACCTTCCTCCATCTCACTCTCACCTA
ACAATCTCTAA