Details for Capsella Locus Carubv10015736m

Position : scaf_3 ( 5`- 391742 .. 392859 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015736m

Protein [Map View]
MDTEIGNKEEQWKNSVSSFSSSRSSSITSDSSDGHFDIRHFPLPKPSLSAQKLRESHQAYDPNRIPSSVFSSKPGNSADW
SIASNESLFSIHDGSFNISTREDHGFAAPLRLAEIPRLEEPAHEIDPVPIPLALPPVKKPDESVKEIIAEEEQYQVETSD
SEVDDSEIEERRGEVESDDEHEEEEEEMIEAEVLVETETKILEKKEVVQVAKENQPEDSNSIVSHSPSISCRSDTSTNSI
GSFAFPLLQKEDVLIKTPSMEIRGYQLTQSPVLPPQPQPQPQPYSESGTLTELQPESQQQQPQRKASKKMESRTQSLKAS
RIGWFSCFHCPSKCGLFK*

DNA
ATGGATACAGAAATTGGAAACAAAGAAGAACAGTGGAAGAATTCGGTTTCTTCCTTTTCATCATCACGATCATCATCGAT
AACATCTGATTCTTCAGATGGACACTTTGATATCCGACACTTTCCTCTTCCCAAGCCATCGCTGTCGGCACAGAAACTGA
GAGAGTCACATCAGGCTTATGATCCAAACCGTATTCCATCTTCGGTTTTCTCTAGCAAACCGGGTAATTCGGCGGATTGG
AGCATAGCTTCTAACGAATCCTTGTTTAGCATCCACGATGGGAGTTTTAACATTTCGACAAGGGAAGATCATGGATTTGC
TGCACCCTTGAGGTTGGCTGAGATACCGAGACTCGAAGAACCAGCTCACGAAATCGACCCGGTTCCTATTCCGCTTGCTC
TTCCTCCGGTTAAGAAACCAGATGAATCTGTGAAAGAGATTATTGCAGAGGAGGAACAATACCAGGTGGAGACCTCAGAC
TCTGAGGTCGATGATAGCGAAATAGAAGAGAGGAGGGGTGAAGTCGAGAGCGATGATGAACACGAAGAAGAAGAAGAAGA
AATGATAGAAGCAGAGGTTTTGGTGGAAACTGAAACCAAAATTCTAGAAAAGAAGGAAGTAGTACAAGTTGCGAAGGAGA
ATCAACCAGAAGACTCCAACAGTATAGTTTCACATTCCCCGAGCATTTCTTGTCGTTCGGACACCAGCACCAACAGCATT
GGCTCTTTCGCATTCCCACTACTGCAAAAAGAAGATGTACTTATCAAAACGCCATCTATGGAAATCAGAGGGTATCAGCT
GACTCAGTCGCCGGTGCTACCTCCCCAACCACAGCCCCAGCCGCAGCCTTATTCAGAATCTGGTACGCTAACTGAGTTGC
AGCCGGAATCACAACAACAACAACCACAACGGAAGGCATCCAAAAAAATGGAGTCTCGAACGCAATCGCTAAAAGCTTCG
AGAATCGGTTGGTTCTCTTGCTTCCATTGTCCTTCAAAATGCGGTTTATTTAAGTAG