Details for Capsella Locus Carubv10015727m

Position : scaf_3 ( 5`- 13486714 .. 13487132 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015727m

Protein [Map View]
MILKLLLLVSLLVVVIRQSYAVADYCDGDDDCKLVCIPPYACNLTRHLCMCNPNPSHDHASSSEEHCIPGHKDCGGIH*

DNA
ATGATCTTGAAGCTTTTGTTATTGGTTTCTCTTCTAGTTGTTGTCATCCGACAAAGTTATGCGGTTGCGGATTATTGCGA
TGGAGACGATGACTGCAAACTGGTATGCATACCACCTTACGCTTGCAACCTAACCCGACACCTTTGTATGTGTAACCCAA
ACCCAAGTCATGATCATGCCAGTTCTTCTGAAGAACATTGTATTCCAGGACACAAAGATTGTGGTGGCATCCACTGA