Details for Capsella Locus Carubv10015726m

Position : scaf_3 ( 5`- 5942016 .. 5943429 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015726m

Protein [Map View]
MDHRTRMVLVLTLVVMSAWGSDASAMQKTKFDAPLLTEKIATNRSIIVDIEGKGDYTSVQKAIDAVPVGNSNWIIVHVRK
GIYKERVHIPENKPFIFMRGNGKGKTVIESSQSSVDNVASATFKVEANHFVAFGISIRNDAPVGMAFTSENQSVAAFVAA
DKVAFYHCAFYSLHNTLFDNKGRHYYHECYIQGSIDFIFGRATSVFNNCEIFVVSDKRVKPYGSITAHHRESAEENTGYV
FIRGKVYGIDEVYLGRAKGPYSRVIFAKTYLSKTVVPDGWTNWSYHGSTENLYHGEYKCHGPGAERQQRSDWAKELTKQE
VESFLSIDFIDGTSWLPVWLQQKS*

DNA
ATGGATCATCGAACAAGAATGGTTCTTGTTCTAACCCTAGTTGTAATGTCCGCATGGGGTTCGGACGCATCAGCAATGCA
AAAGACTAAATTCGACGCGCCCCTACTTACTGAAAAAATCGCAACAAATAGATCAATAATTGTCGATATTGAAGGCAAAG
GAGACTACACTTCTGTTCAAAAGGCCATTGATGCTGTCCCTGTTGGTAACTCCAATTGGATTATCGTCCATGTCCGTAAA
GGAATCTACAAAGAGAGAGTGCACATTCCAGAGAACAAACCGTTCATATTCATGAGGGGTAATGGAAAGGGCAAAACGGT
AATCGAATCATCACAAAGTTCGGTCGACAATGTTGCTTCAGCCACTTTCAAAGTGGAAGCTAATCACTTTGTTGCTTTTG
GTATAAGCATAAGAAATGATGCTCCTGTGGGAATGGCATTCACGTCTGAAAATCAATCCGTAGCAGCGTTTGTGGCTGCC
GACAAAGTAGCGTTTTACCATTGTGCGTTCTACAGCTTACACAACACTTTGTTTGATAACAAAGGTAGACATTACTACCA
TGAGTGTTACATTCAAGGCTCCATAGACTTCATCTTCGGTCGTGCAACTTCCGTTTTCAACAATTGTGAGATTTTTGTGG
TATCGGACAAGAGGGTGAAACCGTATGGGTCAATTACAGCACACCATAGAGAAAGTGCAGAGGAAAATACGGGTTATGTG
TTCATTAGAGGCAAAGTGTACGGAATTGACGAGGTTTATTTGGGTCGGGCCAAAGGACCTTATTCTCGAGTCATCTTTGC
CAAGACTTACTTGTCCAAGACTGTTGTCCCTGATGGTTGGACTAACTGGAGTTACCATGGCTCTACTGAGAATCTATACC
ATGGAGAGTACAAGTGTCATGGACCAGGAGCTGAGAGGCAACAAAGATCTGATTGGGCCAAAGAGCTTACAAAACAAGAA
GTTGAGTCTTTCTTGTCCATTGATTTTATTGATGGAACTTCTTGGCTCCCTGTTTGGCTTCAACAAAAGTCTTAA