Details for Capsella Locus Carubv10015721m

Position : scaf_3 ( 5`- 3767080 .. 3767811 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015721m

Protein [Map View]
MGSKQPYLNGAYYGPSIPPPPAKSQRRSYNSPGFGCCCFSCLGSCLRCCGCCVLSLICNILIAVAVILGIAALILWLIFR
PNAVKFYVSDANLDRFSLDPNSNNLHYSLDLNLTIRNPNQRVGVYYDEISVSGYYGDQRFGSVNVSSFYQGHKNTTVIGA
KMEGQNLVVLGDGARTDLKEDEKSGIYRIGAKLRLSVRFKFWFIKSWKVKPKMKCDDLKIPLGSSNSTGGFKFQPVQCEL
DIS*

DNA
ATGGGGTCTAAACAACCATACCTAAACGGCGCGTACTACGGCCCATCCATTCCTCCGCCGCCGGCTAAATCTCAACGCAG
ATCATACAACTCGCCTGGGTTCGGATGCTGCTGCTTCAGCTGCCTCGGAAGCTGTCTTCGCTGCTGCGGTTGCTGCGTCT
TAAGCCTCATCTGCAACATCCTCATAGCTGTAGCCGTAATCCTCGGAATCGCCGCTCTTATCCTCTGGCTCATCTTCCGT
CCCAACGCCGTCAAATTCTACGTCAGCGACGCTAATCTGGACCGGTTCAGCCTCGATCCGAACAGCAACAACCTCCATTA
CAGCCTCGACCTCAATCTCACAATCCGTAACCCTAACCAACGAGTCGGGGTTTACTACGACGAGATCTCGGTTAGTGGCT
ATTACGGAGATCAGAGGTTCGGATCTGTGAACGTTTCGTCGTTTTACCAGGGGCATAAGAATACGACGGTGATCGGAGCC
AAAATGGAAGGACAGAATCTGGTGGTGCTCGGCGACGGAGCGAGGACGGATCTCAAGGAAGACGAGAAATCTGGGATTTA
CCGGATCGGTGCGAAGCTAAGACTAAGTGTCCGGTTTAAGTTTTGGTTTATCAAGTCGTGGAAGGTTAAACCAAAGATGA
AGTGTGATGATCTTAAGATTCCTCTCGGTTCCTCTAACTCTACCGGAGGGTTTAAGTTTCAACCAGTGCAGTGTGAGCTT
GACATATCTTAG