Details for Capsella Locus Carubv10015712m

Position : scaf_3 ( 5`- 2810512 .. 2811528 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015712m

Protein [Map View]
MGLFITLSLLFLSCFEIHGTMAADESSTFSFDGFVKSPTFDKSVALFGDSKLVTDTSLIQLTDSVSGRVGRVVYRKPVSL
FQGKERNSLSFSTHFSFSSMSDEIGDDDILSFVMVPSSLDLSLFGKKDNNFSALEFLLQNAKNETVVAVEFDISKIGNCA
RILIGGPESAEIRNLSFVGDLMMNNGGTLSCMIDYEANSKRMMVRFRKSGSIKLFDPFFSFSLDLAKLWEDGQVTVGLSS
ANGNSSKAHFLHSWSFETRHPPPMWMHSEPLEPNEVSTEEKEGRGRSECIWKVLGALVLGAACGSLGVMLALYLWTICRV
RRSMAVVPEESPIEQGKK*

DNA
ATGGGGCTGTTCATAACCTTATCTCTTTTGTTCCTTTCATGCTTTGAGATACATGGAACCATGGCTGCAGATGAGAGTTC
CACGTTTTCGTTCGATGGGTTTGTCAAGTCTCCGACTTTTGACAAGAGTGTTGCACTGTTCGGGGATTCGAAGCTGGTCA
CTGACACTTCTTTGATTCAGCTGACTGACTCAGTGAGTGGACGCGTGGGACGAGTCGTTTACAGGAAACCCGTCAGCCTT
TTCCAAGGTAAAGAGAGGAACTCGCTTTCTTTCTCGACTCACTTCTCGTTTTCTTCCATGTCCGATGAGATTGGTGATGA
TGATATCTTGTCTTTTGTAATGGTTCCAAGTAGTTTGGATCTTAGTCTGTTCGGTAAAAAAGATAACAATTTCTCTGCTT
TAGAGTTTCTATTACAAAATGCAAAGAACGAGACAGTTGTTGCTGTTGAGTTTGATATCTCCAAGATAGGAAACTGTGCA
AGAATCTTAATTGGTGGACCTGAATCTGCCGAAATCAGAAACCTTTCCTTTGTTGGTGACTTGATGATGAACAATGGAGG
GACTTTGAGCTGTATGATTGATTACGAGGCAAATTCTAAGAGAATGATGGTTCGGTTCAGAAAATCTGGTTCCATAAAGC
TCTTTGATCCATTCTTCTCTTTCTCGCTAGACTTGGCCAAGTTATGGGAAGATGGTCAAGTCACTGTGGGTTTAAGCTCT
GCCAATGGAAACTCTTCCAAGGCACATTTTCTCCATTCATGGAGCTTTGAAACAAGGCATCCTCCTCCAATGTGGATGCA
TTCAGAGCCACTTGAACCGAATGAAGTTTCCACGGAGGAGAAAGAGGGTCGAGGGAGAAGTGAGTGTATATGGAAAGTGC
TTGGTGCTTTGGTTTTGGGTGCAGCTTGTGGATCCTTAGGGGTAATGTTGGCTTTGTATCTCTGGACTATATGCCGTGTT
AGGCGGTCAATGGCCGTGGTTCCAGAGGAAAGTCCTATTGAACAAGGCAAGAAGTAG