Details for Capsella Locus Carubv10015711m

Position : scaf_3 ( 5`- 2426176 .. 2426739 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015711m

Protein [Map View]
MTGVENGVRMTSPSSTSSIATTSVHVSALDGLVNVNSLFTIAVFVGLSLATPGQHSLEQRSSCDASADVAKKLLVFEVVS
FSFFLFSSLVAQGLKLALNLLNSKDVDEIFRAHINIKVLRWGMMASAVGSVMGCLFLMLSMVDVIQIRLGLLSCGSQPAA
QAVATLVTLVSSALLVYISTAIYAFWH*

DNA
ATGACCGGCGTTGAGAACGGCGTGAGAATGACGTCGCCGTCTTCAACATCCTCAATCGCCACCACAAGTGTCCACGTAAG
CGCTCTCGATGGACTCGTGAACGTTAACTCTCTATTCACCATCGCCGTCTTCGTAGGCCTTTCCTTAGCGACTCCAGGAC
AACACAGCCTCGAACAACGATCCAGCTGCGATGCAAGTGCTGATGTGGCCAAGAAGCTGCTTGTCTTCGAAGTCGTCTCC
TTCAGCTTCTTCCTCTTCTCCTCTTTGGTAGCTCAGGGTCTCAAGCTTGCCCTAAACCTTCTCAACAGCAAAGACGTCGA
TGAGATTTTCAGAGCTCACATCAACATTAAGGTTTTGAGATGGGGAATGATGGCTTCTGCTGTCGGATCTGTCATGGGCT
GTCTGTTCTTGATGCTCTCTATGGTTGATGTGATTCAGATCCGTCTTGGGTTGCTCTCTTGCGGCAGTCAACCGGCGGCC
CAAGCGGTAGCAACGCTCGTGACTCTGGTTTCCTCTGCTCTGTTGGTTTACATCTCTACTGCCATTTACGCTTTCTGGCA
TTGA