Details for Capsella Locus Carubv10015700m

Position : scaf_3 ( 5`- 9621119 .. 9622140 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015700m

Protein [Map View]
MTSLPIISASSPPRNLNLTKPSSSTSQTPKPIHISPKQLLTKTHLSLTIPQLILTSPVLASESSFDSISDPPTGKIDLES
ILVTIDNFFNKYPFFVAGCTFMYLVVYPAVIFYLRKYKPISAMNAFRKLKNEPDSQLLDIRDEKTLALLASPNLKFLGKS
SVQVPFSESDEEEFLKRVKGCFSVPEDTVVCVLDNFDGNSSKVAELLIENGFKEAYYIRGGARGKNGWLAIQEELLPPPV
HMYTAKNVNSSNNNEASVVGTEN*

DNA
ATGACGTCTCTTCCGATAATCTCCGCATCCTCTCCTCCGCGAAACCTAAACCTAACCAAACCATCTTCTTCAACATCTCA
AACCCCAAAACCAATTCACATTTCACCAAAACAACTCCTAACCAAAACCCATCTCTCTCTCACCATTCCCCAACTCATCC
TCACATCCCCTGTTCTCGCATCTGAGTCGTCCTTCGACTCAATCTCAGACCCACCAACCGGAAAAATCGATTTGGAGTCA
ATCTTGGTCACAATTGACAATTTCTTCAACAAGTATCCATTTTTCGTAGCTGGGTGTACTTTCATGTACCTTGTGGTTTA
CCCTGCTGTGATTTTTTACTTGAGGAAGTATAAACCAATCTCTGCCATGAACGCGTTTCGTAAGCTCAAGAACGAGCCTG
ATTCGCAGCTTTTGGATATTAGAGATGAAAAGACTTTGGCTTTATTGGCGTCGCCGAATCTTAAGTTTCTTGGTAAGAGT
TCAGTTCAGGTTCCGTTTAGTGAGAGTGATGAGGAAGAGTTCTTGAAGAGAGTTAAAGGATGCTTCTCTGTTCCTGAGGA
TACTGTTGTTTGTGTTCTTGACAATTTTGATGGTAACTCTTCGAAAGTGGCTGAATTGCTGATTGAGAATGGCTTCAAAG
AGGCTTATTATATCAGGGGAGGTGCCAGAGGGAAGAATGGTTGGTTGGCCATTCAAGAAGAGCTTTTGCCTCCACCTGTG
CATATGTATACTGCAAAAAATGTGAATTCTTCAAACAACAATGAAGCATCGGTTGTTGGAACTGAAAACTAG