Details for Capsella Locus Carubv10015687m

Position : scaf_3 ( 5`- 502074 .. 504008 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015687m

Protein [Map View]
MVPPLLKLEFTQGPRAGDSLGFKPGSTIRIGRIVRGNEIAIKDAGISTKHLRLVSDSENWIIHDLGSSNGTILNSETIDP
DNPINLSHGDEIKLGEYTSIVVNFVSDVQAPQEHKLPPRPRRNNKRLAVSDPDPDPIESVQEKPKRTRRSSKQEESELPK
RTRASKKKTLEEIVDKEEEVEVKVEKKVNSRVGRPQKNANSAITKEDELPEDERGNSRVQRGKNSESVQNLGLDSIKLEV
EDTPKRVEISEVKSRKRATRSKQIENACLGLGNVKTEDTVLEVKDAKRATRATRSTKNEIGGDSFLELEMVLSLARKSRA
KRRKMEQEPSKSVVEMETRNDDTGEEVLKNCHVEEDKENEAQGVRNERSDDKCDREEEREGDGSKRVETDLRKKNTIGED
DLNCTVREHGETENLQDIEEDNGNKAQEGCSASSDEKCDKEDGREGDGSKSVEQVEIELRKKSTIAEDDLSCTVIEDGET
ESLQDIEEENGNEAQEGYSERSDDKCDKEDEREGDGSKRVEQVEIEIELTKQSTIGEDDLNCTVREDADTGSLQQIEKEC
HEEAGMATLVDDCEEEKVEQGSSNWNVERVEVDIRKMTLRNWFDSMEAQLRKQTIEETEKMIEPMRSKTLRVYKHIAEQK
EKGV*

DNA
ATGGTTCCGCCATTGCTGAAGCTCGAGTTCACCCAGGGTCCAAGAGCTGGCGATTCTCTAGGGTTCAAACCCGGATCCAC
TATTCGGATTGGTCGAATCGTTCGTGGTAATGAAATCGCCATCAAAGACGCCGGAATCTCTACCAAGCACCTCCGGCTCG
TCTCCGATTCGGAGAACTGGATAATCCACGATCTAGGGTCTTCCAACGGCACCATATTAAACTCCGAAACTATCGACCCA
GATAATCCTATCAATCTTAGCCATGGAGACGAAATCAAGCTTGGTGAGTACACTTCCATTGTGGTGAACTTTGTGAGTGA
CGTTCAGGCGCCGCAGGAACATAAGCTTCCGCCTAGGCCAAGGAGGAATAACAAGCGTCTCGCTGTTTCGGATCCGGATC
CGGATCCTATTGAGTCGGTTCAGGAGAAGCCAAAGCGCACGCGTAGATCGTCGAAGCAAGAGGAAAGTGAACTACCCAAG
AGAACTAGGGCATCGAAGAAGAAAACTCTGGAAGAAATCGTCGACAAAGAAGAGGAAGTGGAGGTAAAAGTTGAGAAAAA
GGTCAATTCTAGGGTTGGGAGGCCCCAGAAGAACGCAAATAGTGCAATTACGAAGGAAGATGAACTTCCGGAGGATGAAA
GAGGAAACTCTAGGGTTCAGAGAGGTAAGAACAGTGAAAGTGTCCAGAATTTGGGTTTGGATTCGATCAAATTGGAAGTT
GAGGATACCCCAAAAAGAGTAGAAATCTCAGAGGTAAAAAGCAGGAAGAGAGCGACAAGGAGCAAGCAGATTGAAAATGC
ATGTTTGGGATTGGGGAATGTAAAGACTGAGGATACTGTTTTAGAAGTTAAAGATGCGAAGAGAGCTACAAGGGCTACCA
GAAGCACCAAGAATGAAATTGGTGGAGATTCCTTTCTGGAGTTGGAGATGGTCCTGAGCCTAGCCCGGAAGAGCCGTGCA
AAGAGGAGGAAAATGGAGCAGGAGCCGTCCAAGAGCGTCGTGGAGATGGAAACTAGAAATGATGATACCGGAGAAGAGGT
CTTGAAGAACTGTCATGTTGAAGAAGATAAGGAAAATGAAGCTCAGGGAGTTCGCAATGAGAGAAGTGATGACAAATGTG
ATAGAGAAGAGGAGAGGGAAGGGGATGGATCTAAGAGGGTGGAGACTGATTTGAGGAAGAAGAACACAATAGGAGAAGAT
GACCTGAATTGTACTGTTAGAGAACATGGAGAGACTGAGAACTTGCAAGATATTGAAGAAGATAATGGAAATAAAGCTCA
GGAAGGTTGCAGTGCAAGCAGTGATGAAAAATGTGATAAAGAAGATGGGAGGGAAGGTGATGGTTCTAAGAGTGTAGAGC
AGGTGGAGATTGAGTTAAGGAAGAAGAGCACCATAGCAGAAGATGACCTGAGCTGTACTGTTATAGAAGATGGAGAGACT
GAGAGCTTGCAAGATATTGAAGAAGAAAATGGAAATGAAGCTCAGGAAGGTTACAGTGAAAGAAGTGATGATAAATGTGA
TAAAGAAGATGAGAGGGAAGGTGATGGATCTAAGAGGGTAGAGCAGGTGGAGATTGAGATTGAGTTAACGAAGCAGAGCA
CCATAGGAGAAGATGACCTGAACTGTACTGTTAGAGAAGATGCAGACACAGGAAGCTTACAACAAATTGAAAAAGAATGT
CATGAGGAAGCTGGAATGGCGACATTAGTTGATGATTGTGAAGAGGAAAAGGTTGAGCAGGGATCGAGCAATTGGAATGT
AGAGAGGGTAGAAGTAGATATAAGAAAAATGACACTAAGAAACTGGTTTGATTCCATGGAGGCTCAACTGCGAAAACAGA
CAATTGAAGAGACAGAGAAGATGATTGAGCCCATGAGAAGTAAGACTCTAAGAGTTTACAAGCATATTGCAGAGCAAAAG
GAAAAGGGCGTGTAA