Details for Capsella Locus Carubv10015684m

Position : scaf_3 ( 5`- 5645746 .. 5648601 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015684m

Protein [Map View]
MDTSRRAVESYWRSRMIDAVTSDEDKVAPVYKLEEICDLLRSSHVSIVKEFSEFILKRLDNKSPIVKQKVRMKALCVLEA
ILRKKEDDNFSIVHSYFDENMDAIQRCSESPQSSLREKANKVLNLLNGGQSSGLMSSSDNTVKREAAVDLPDLIDTGYSD
YTTEDILNQPNIIDTGSTVATAAPLMDDDWFGDSTDTGMGSSEKKNDDDPFADVSFHPNEEKESADDLFSGMTVGEKSAA
GDGNHVPELFDMFGSTANLEAEPKESKNINDLMASFSIDENNSNQKGSSSSTLPDNLFAMPSTTSHQGPENPVGGIVGSQ
NPGFIQNSMLPGGVMPFNFPPGMMMNPAFAQPMNYAAMASLLAQQQQYLGNISNFQQFGNLNAQGSGNVHSMGTSGGNQS
ALPDIFQPNFANQAPTSTMNGSKKEDTRAFDFISDHIASARDTKRVS*

DNA
ATGGATACGAGTAGGAGAGCTGTGGAATCGTATTGGAGGTCGCGGATGATAGATGCGGTTACGTCTGATGAGGACAAAGT
AGCGCCTGTGTATAAGCTGGAAGAGATCTGTGACCTTCTTCGTTCTTCTCATGTGAGCATCGTGAAGGAGTTTTCGGAAT
TCATTTTGAAACGTCTTGATAACAAGAGCCCCATCGTTAAGCAGAAGGTTCGGATGAAAGCTCTATGTGTCCTTGAAGCC
ATTTTGAGGAAGAAGGAAGATGATAATTTTTCAATTGTACATAGTTATTTTGATGAAAACATGGATGCCATTCAGCGATG
CTCAGAGTCTCCGCAATCTTCCCTTCGCGAAAAGGCTAACAAGGTGCTAAACCTTCTAAATGGTGGACAGTCAAGTGGGC
TGATGAGCAGCTCAGATAATACTGTGAAGCGAGAGGCTGCTGTTGATTTACCTGACTTGATCGACACCGGTTATTCAGAT
TATACAACAGAAGATATTTTAAACCAGCCAAATATTATAGATACTGGCAGTACAGTAGCAACAGCAGCTCCATTGATGGA
TGATGATTGGTTTGGGGATAGCACTGACACTGGAATGGGTAGCAGTGAGAAGAAAAACGATGATGACCCCTTTGCAGATG
TATCGTTTCATCCAAATGAAGAAAAAGAAAGTGCAGATGACCTGTTCTCTGGAATGACTGTCGGGGAAAAATCCGCTGCT
GGTGATGGTAATCACGTGCCTGAGCTATTTGATATGTTTGGGTCGACTGCAAATCTTGAAGCAGAGCCAAAAGAATCTAA
AAACATAAATGATTTGATGGCAAGTTTTTCCATTGACGAGAACAATTCAAATCAGAAAGGCTCGTCTTCAAGTACCCTTC
CAGATAATTTATTTGCAATGCCGAGCACCACCAGCCACCAAGGACCTGAAAATCCTGTTGGGGGCATTGTTGGTTCACAA
AACCCTGGGTTTATTCAAAACTCAATGCTTCCTGGGGGTGTTATGCCCTTCAATTTTCCTCCAGGGATGATGATGAATCC
AGCTTTTGCTCAACCTATGAATTACGCTGCCATGGCAAGCTTGTTAGCTCAGCAGCAGCAGTACCTTGGTAATATATCCA
ACTTCCAGCAGTTTGGCAACTTGAACGCTCAGGGTAGTGGGAATGTTCATTCTATGGGTACTAGCGGAGGGAATCAGTCA
GCACTCCCTGATATATTCCAACCAAATTTTGCTAATCAGGCTCCAACCTCAACAATGAATGGTTCGAAAAAAGAAGATAC
AAGAGCATTCGATTTCATCTCTGATCATATTGCATCAGCTCGCGACACAAAGAGAGTATCTTGA