Details for Capsella Locus Carubv10015682m

Position : scaf_3 ( 5`- 6840246 .. 6843276 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015682m

Protein [Map View]
MGVLSNLRGSKIGSTHEELPVANGSSSSFRRKVSSFLPIFVALVVIIEIGFLCRLDDATLVDTLTGFFTKSSSDLKVGSG
MEKCIEWLERVDSVTYSRDFSKDPIFISGGDKEFQSCSVHCTMGFTSDKKPDAAFGLGHQPGTLSIIRSMESAQYYQQND
LSHARRRGYNIVMTTSLSSDVPVGYFSWAEYDIMAPVQPKTEKALAAAFISNCAARNFRIQALEALMAANVKIDSYGGCH
RNRDGRVEKVEALKHYRFSLAFENTNEEDYVTEKFFQSLVAGSVPVVVGAPNIKEFAPSPESFLHIKQIDDVNSVAKRMK
YLVENPDAYNQTLRWKHEGPSDSFKALVDMAAVHSSCRLCIFVATKIREQEEKSPEFKRRPCKCTRGSETVYHLYVRERG
RFDMESIFLKDGNLTLKALKSAILAKFKSQGHEPIWKKERPASIRGDSELRVHGIYPLGLTQRQALYNFKFEGNSSLNTH
IQRNPCAKFEVVFV*

DNA
ATGGGTGTTCTCTCCAATCTTCGAGGATCTAAAATTGGATCGACCCATGAAGAATTGCCTGTAGCAAATGGCTCTTCTTC
CTCTTTCAGGCGTAAAGTGTCGAGCTTTTTGCCTATCTTTGTGGCTCTCGTTGTCATCATCGAGATCGGGTTTCTGTGTC
GGCTCGATGACGCTACTTTGGTCGATACATTGACCGGTTTTTTCACCAAGTCGTCGTCCGATTTGAAGGTTGGGTCGGGA
ATGGAGAAATGCATAGAGTGGTTGGAGAGAGTGGATTCAGTGACTTATTCTAGAGATTTCAGTAAAGATCCCATCTTTAT
CTCTGGTGGTGATAAGGAGTTCCAATCGTGTTCTGTTCATTGTACAATGGGATTCACTTCAGATAAGAAACCCGATGCGG
CTTTTGGATTAGGTCATCAACCTGGAACACTCAGTATAATCCGTTCCATGGAATCAGCACAGTACTACCAACAGAACGAT
CTTTCTCATGCACGACGGAGGGGTTATAATATTGTGATGACAACTAGTCTTTCTTCAGATGTTCCTGTTGGGTATTTCTC
ATGGGCAGAATATGATATTATGGCTCCAGTGCAACCAAAGACCGAGAAAGCTCTTGCGGCAGCTTTTATTTCCAATTGTG
CGGCTCGGAATTTCAGGATTCAAGCTCTTGAAGCTTTAATGGCGGCGAATGTTAAGATTGATTCTTATGGTGGTTGTCAC
CGGAACCGAGATGGGAGAGTGGAGAAGGTTGAGGCTCTTAAGCACTACAGATTCAGTCTAGCTTTTGAGAACACCAACGA
GGAGGATTATGTCACAGAGAAGTTCTTCCAATCTCTAGTCGCTGGATCTGTCCCTGTGGTTGTTGGAGCTCCAAATATAA
AAGAATTTGCACCTTCTCCAGAGTCATTCCTTCACATAAAGCAGATTGATGATGTCAACTCAGTTGCAAAGAGAATGAAG
TATCTTGTGGAAAACCCTGATGCCTACAATCAGACACTAAGATGGAAACACGAAGGCCCTTCGGATTCTTTTAAGGCACT
AGTTGATATGGCTGCTGTCCACTCTTCTTGCCGTCTCTGCATATTCGTGGCTACAAAGATCCGGGAGCAAGAAGAGAAGA
GCCCTGAGTTTAAGAGACGACCTTGCAAATGCACTAGAGGCTCAGAGACAGTTTACCATTTGTATGTTAGAGAAAGAGGC
CGGTTCGATATGGAATCAATCTTCTTAAAGGATGGGAATCTGACTTTGAAAGCCCTGAAATCTGCAATTCTCGCAAAGTT
CAAGTCTCAGGGACATGAGCCAATATGGAAGAAGGAGAGACCAGCGAGCATAAGAGGAGACAGTGAGCTTAGAGTACACG
GGATATACCCGCTTGGTTTGACTCAAAGACAAGCCCTTTACAACTTCAAATTCGAAGGAAACTCAAGTCTCAATACTCAC
ATACAGAGAAACCCTTGTGCCAAGTTTGAAGTTGTCTTCGTCTAA