Details for Capsella Locus Carubv10015676m

Position : scaf_3 ( 5`- 8850060 .. 8852063 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015676m

Protein [Map View]
MGTEVALKSQGEGCCKSGPGHASPLLAMSGPREELIYVAAIYTGTGQAKPDYLATVDVEPSSSTYACVIHRLPMPFLGDE
LHHSGWNSCSSCYGDPSCERRYLILPSLLSGRIYVIDTKTNPREPFLYKFLEPAEVLEKTGLAYPHQPHCLTSGDVLVSC
LGDEDGNAEGSGFLLLDSEFNIKGRWEKDGNSPLYGYDFWYQPRHKTMISTSWGAPAAFTKGFDLKDVSDGLYGKHLHVY
SWPEGELKQILDLGDTGLLPLEVRFLHNPDKATGFAGCALSSTIVRFFKNEDETWSHEVAISVEPLKVENWILPEMPGLI
TDFLISLDDRFLYFSNWLHGDIRQYNIEDPKTPVLTGQLHVGGLVQKGSPVFALGEDGNMFQFDVPKIKGQRLRGGPQMF
QLSLDGKRLYVTNSLFSVWDRQFYPELVEEGSHMLQIDVDTDKGGLSINPNFFVDFGSEPDGPALAHEMRYPGGDCTSDI
WV*

DNA
ATGGGAACGGAAGTAGCGTTGAAAAGCCAAGGGGAAGGTTGCTGCAAGAGCGGACCGGGTCATGCCTCGCCTCTTCTCGC
CATGTCTGGTCCACGAGAGGAACTCATTTATGTTGCTGCCATATACACCGGAACTGGACAAGCGAAGCCAGATTACTTAG
CTACGGTCGATGTGGAACCAAGTTCATCGACATACGCTTGTGTCATCCACAGATTACCTATGCCTTTTCTTGGAGATGAA
CTTCATCATTCAGGCTGGAACTCTTGTAGCTCTTGCTATGGTGATCCTTCTTGCGAAAGACGTTATCTCATCTTGCCTTC
TCTTCTGTCTGGTCGTATCTACGTTATAGATACGAAAACAAACCCTAGGGAACCATTTCTTTATAAATTTTTGGAGCCAG
CGGAGGTTTTGGAGAAGACGGGGTTGGCTTATCCGCATCAACCTCATTGCTTAACTTCCGGAGACGTTCTTGTGTCTTGT
CTTGGGGACGAAGATGGAAACGCAGAAGGCAGTGGGTTTCTCTTACTCGATTCCGAGTTTAATATAAAAGGAAGGTGGGA
GAAGGATGGAAACAGCCCTTTGTATGGGTATGATTTCTGGTACCAACCTCGGCACAAGACGATGATTAGTACCTCTTGGG
GAGCACCAGCCGCGTTTACCAAAGGTTTTGACCTCAAGGACGTCTCTGATGGCTTGTATGGAAAGCATCTACATGTTTAT
AGTTGGCCTGAAGGAGAGTTGAAACAGATACTTGACCTTGGAGATACAGGACTTTTACCCTTAGAGGTAAGATTCTTGCA
CAACCCGGATAAAGCTACGGGATTTGCAGGGTGTGCGTTATCTAGTACTATTGTAAGATTTTTCAAGAACGAAGATGAAA
CATGGAGCCACGAGGTGGCTATATCAGTGGAACCTCTGAAAGTTGAGAACTGGATTCTCCCAGAAATGCCAGGGCTTATC
ACTGACTTCTTAATCTCACTTGACGACCGGTTCCTCTATTTTTCCAACTGGCTTCATGGAGATATTCGCCAGTACAACAT
CGAGGACCCGAAAACCCCTGTTTTAACCGGTCAACTACATGTAGGTGGGCTAGTACAAAAGGGAAGCCCTGTCTTTGCCT
TGGGAGAAGATGGGAACATGTTTCAGTTCGATGTCCCTAAGATCAAGGGTCAGCGTCTAAGAGGAGGTCCTCAAATGTTT
CAGTTGAGCCTAGATGGGAAGCGATTATACGTAACAAACTCGCTGTTTAGCGTTTGGGACAGACAGTTTTACCCAGAACT
TGTGGAGGAAGGCTCACACATGTTACAAATTGATGTTGATACAGACAAAGGTGGTCTCTCCATAAACCCTAACTTCTTCG
TCGACTTTGGGTCCGAACCAGATGGTCCTGCGCTGGCTCACGAGATGAGATATCCTGGTGGTGACTGCACCTCCGATATA
TGGGTTTAG