Details for Capsella Locus Carubv10015673m

Position : scaf_3 ( 5`- 8704188 .. 8709935 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015673m

Protein [Map View]
MVIPGRRTVWDGVIQLTKMSQENCIDPRLWASQLSSNLNFFAVEFPSTELAEVIVSYICWDNNVPILWKFLERAMALNLV
SPLVVLSLLSHRVVPNRNTQLAAYRIYLELLKRYMFTIKDHITGPHYHKVMISVASILRLSELFDLETNEPGVILVEFVF
EVVSQLLDATLSDEGLLELSQDSSSLSQKMEIDAPERYNGKTGSLEKLQSLNTIMVVEMIAEFLKNTVVSRLLYLVSSNR
ASNWHEFVQKVQLLGENSSALKNSKILNPGDLLKLISNKRFRYSYDCKVTSSRKSNAIVDFGSLSSFAGLCHGASISSLW
LPLDLVFEDAMDGYQVNPTSAIEIITGLAKTLKEINGSTWHDTFLGLWIAALRLVQRERDPIEGPIPRLDTRLCMSLCIV
PLVVANLIEEGIYVSVTEKLQDDLVTSLQVLGDFPGLLAPPKCVVSAANKAATKAILFLAGANISDVINMKDMPMNCSGN
MRHLIVEACIARNILDTSAYSWPGYVNGQFNQIPQSLPNELPCWSSFVKGAPLNAAMVNALASVPASSLAELEKLYEVAV
KGSDDEKISAATVLCGASLTRGWNIQEHTVEFLTRLLSPPVSADYSKAESHLITYACMLNVVIVGIGSVDSIQIFSLHGM
VPQLACSLMPICEEFGSYTPSISWTLPTGEKISAYSVFSNAFTLLLKLWRFNHPPIEHGVGDVPTVGSQLTPEHLLLVRN
SYLISSETLNRDRNRKRLSEVARSASCEPVFVDSFPKLKIWYRQHQRCIAATLSGLTHGSPVHQTVEALLSMMFRKVRGS
HTLNPVNSGTSSSSGAASEDSNPRPEFPAWDILKAVPYVVDAALTACTHGKLSPRDLATGLKDLADFLPASLATIVSYFS
AEVSRGVWKPVFMNGVDWPSPATNLSNVEEFIKKILATTGVDIPSLAPGGSSPATLPLPLAAFVSLTITYKIDKASERFL
NLAGPALECLAAGCPWPCMPIVASLWTQKAKRWFDFLVFSASRTVFLHNQDAVNQLLRNCFSATLGLNAAPMSNDGGVGA
LLGHGFGSHFYGGISPVAPGILYLRMYRALRETVSVTEEIFSILIHSVEDIAQNRLSMEKLERLKTVKNGTRYGQSSLAT
AMTQVKLAASLSASLVWLTGGLGVVHLLIKETIPSWFLSTDKSDRKQGPSDLVAELRGHALAYFVVLCGAFAWGVDSRSS
ASKRRRQAILGSHLEFIASALDGKISVGCETATWRTYVSGVVSLMVSCLPLWVAEIDTEVLKSLSNGLRQWGKDELAIVL
LSLGGLRTMDYAANFIIHLRS*

DNA
ATGGTGATACCTGGACGAAGAACCGTCTGGGATGGAGTGATTCAGCTGACGAAGATGTCCCAAGAGAACTGTATCGATCC
TCGTCTTTGGGCTTCTCAGTTATCCTCGAATTTGAACTTCTTCGCTGTTGAGTTCCCTTCGACGGAGCTCGCGGAAGTGA
TTGTTTCCTACATTTGTTGGGATAACAACGTTCCTATTCTCTGGAAGTTTCTCGAAAGAGCTATGGCGTTGAACCTTGTT
TCTCCTCTCGTTGTTCTTTCTCTTCTCTCTCACAGAGTTGTTCCAAATCGGAATACGCAACTAGCTGCTTATAGAATTTA
CTTGGAGCTGCTTAAGAGATATATGTTCACCATTAAAGATCATATTACTGGACCTCACTACCACAAGGTAATGATTTCAG
TAGCTAGCATTCTTCGTCTTTCAGAGTTATTTGATTTGGAAACAAACGAGCCTGGTGTGATTTTAGTAGAATTCGTCTTT
GAGGTGGTGTCTCAACTGCTAGATGCGACATTAAGTGATGAAGGTTTACTAGAGCTAAGCCAAGACTCGAGCTCTCTGTC
TCAAAAAATGGAAATTGATGCTCCTGAGAGATATAATGGAAAGACTGGTTCTCTTGAGAAGTTACAGAGTTTAAATACCA
TCATGGTGGTCGAGATGATTGCGGAGTTCCTTAAGAATACAGTGGTCTCCAGATTGCTATACTTGGTATCCTCCAACAGG
GCTTCAAATTGGCATGAATTTGTCCAGAAAGTGCAGCTGCTTGGAGAAAATTCATCAGCTTTAAAGAATTCAAAGATTCT
AAATCCTGGGGATCTATTGAAGTTGATTTCTAATAAAAGATTTAGGTATTCTTATGACTGCAAAGTGACTTCATCACGGA
AGTCCAATGCTATTGTGGATTTTGGATCACTCTCTTCCTTTGCTGGCTTATGCCATGGAGCAAGTATCTCTTCACTGTGG
CTTCCTCTTGATCTAGTATTCGAAGATGCTATGGATGGATATCAAGTAAACCCAACTAGTGCGATTGAAATCATTACTGG
TCTAGCGAAAACACTTAAAGAAATTAATGGGAGCACTTGGCATGACACTTTCTTGGGTCTTTGGATAGCAGCTCTCCGGC
TTGTTCAAAGGGAAAGGGATCCTATTGAAGGACCTATTCCCCGACTGGACACAAGGCTGTGCATGTCATTATGTATTGTG
CCTCTTGTGGTCGCAAACCTTATTGAAGAGGGGATATACGTATCTGTCACGGAAAAGCTTCAAGATGATCTTGTTACAAG
TTTGCAGGTCCTCGGTGATTTTCCTGGATTGCTGGCTCCTCCTAAGTGTGTAGTTTCCGCCGCCAACAAGGCTGCCACAA
AGGCAATCTTGTTTTTGGCAGGTGCCAATATTTCTGATGTCATAAACATGAAAGACATGCCTATGAACTGCTCTGGAAAT
ATGCGTCACCTGATAGTTGAGGCTTGTATTGCAAGAAACATACTGGATACATCAGCCTATTCGTGGCCTGGCTATGTTAA
TGGCCAATTCAACCAAATACCTCAAAGTCTGCCCAATGAATTACCCTGCTGGTCGTCATTTGTGAAAGGCGCCCCACTAA
ATGCTGCAATGGTGAATGCATTAGCTTCCGTTCCTGCTTCAAGCTTAGCAGAGCTCGAGAAACTATATGAGGTTGCAGTC
AAAGGATCGGATGATGAGAAGATATCTGCTGCTACAGTTCTTTGCGGGGCGTCTCTTACACGGGGTTGGAACATACAGGA
ACACACTGTTGAATTTCTTACAAGATTACTATCCCCACCCGTTTCAGCAGATTATTCCAAGGCTGAAAGTCATTTGATCA
CTTATGCCTGCATGCTGAATGTTGTTATTGTTGGGATAGGATCTGTTGACAGCATTCAGATTTTCTCTTTACATGGCATG
GTTCCACAACTTGCTTGCTCACTAATGCCAATCTGTGAAGAGTTTGGATCTTACACCCCGAGTATATCATGGACTCTGCC
TACCGGAGAAAAAATATCAGCCTATTCTGTTTTCTCAAATGCATTCACTCTTCTTTTAAAGCTTTGGAGATTCAATCATC
CTCCTATTGAGCATGGTGTAGGAGATGTGCCCACAGTTGGCTCCCAACTCACTCCCGAACATCTTCTTTTAGTGCGTAAT
TCTTATCTTATTTCCTCGGAGACCCTTAATAGAGACCGAAACAGAAAGAGACTTTCAGAAGTTGCAAGGTCAGCATCTTG
CGAGCCCGTGTTTGTTGACTCGTTCCCCAAGCTGAAAATCTGGTACAGGCAGCACCAGAGATGCATTGCTGCCACATTAT
CCGGACTTACACATGGATCTCCCGTCCATCAGACAGTTGAAGCACTTCTCAGCATGATGTTCAGAAAGGTCAGAGGCAGT
CACACTTTAAATCCAGTTAATTCGGGCACAAGCAGTTCCTCAGGAGCTGCAAGTGAAGATAGCAATCCAAGACCTGAGTT
TCCTGCCTGGGATATCCTCAAAGCCGTTCCATATGTTGTAGATGCTGCTTTGACAGCTTGTACTCATGGAAAGCTTTCTC
CTCGTGACTTAGCTACAGGGTTGAAAGACTTAGCAGATTTTCTCCCAGCATCATTAGCAACAATAGTAAGCTATTTCTCA
GCTGAGGTGAGTAGAGGTGTTTGGAAACCAGTATTCATGAATGGCGTGGATTGGCCAAGTCCAGCTACAAATCTATCCAA
TGTTGAGGAATTTATAAAGAAAATTCTTGCGACAACAGGTGTTGACATCCCTAGCCTTGCTCCAGGAGGGAGTTCTCCGG
CTACACTTCCTTTGCCTTTAGCCGCCTTTGTAAGTCTAACCATTACTTACAAAATCGATAAAGCCTCAGAGCGCTTTCTT
AACCTGGCTGGCCCAGCACTGGAGTGCTTAGCTGCAGGCTGCCCTTGGCCTTGCATGCCCATTGTAGCTTCATTGTGGAC
TCAAAAGGCAAAACGTTGGTTCGACTTCCTTGTTTTCTCTGCCTCTCGCACCGTCTTCCTTCACAACCAAGACGCTGTGA
ATCAGCTCCTCAGAAACTGCTTCAGTGCCACTCTTGGTTTGAATGCTGCCCCCATGTCAAACGATGGTGGCGTTGGAGCT
CTTCTTGGCCATGGATTTGGCTCTCATTTCTATGGTGGGATCTCACCTGTAGCACCAGGGATTCTCTATCTCCGCATGTA
TCGTGCTCTCAGAGAAACTGTTTCTGTAACAGAAGAGATTTTCTCTATCCTGATACATTCAGTGGAGGATATTGCCCAGA
ACCGGCTCTCAATGGAGAAGCTGGAAAGGCTGAAGACAGTGAAGAACGGAACAAGATACGGCCAAAGTTCTCTAGCAACA
GCGATGACTCAAGTCAAGCTTGCTGCTTCACTTAGTGCCTCGTTGGTATGGCTAACCGGTGGCTTAGGTGTAGTCCACCT
ACTCATCAAAGAAACCATCCCGTCTTGGTTTCTATCAACTGACAAGTCAGACCGAAAACAAGGACCATCGGATCTAGTTG
CTGAGCTTAGAGGTCATGCCCTTGCCTACTTTGTAGTCCTATGCGGAGCATTTGCTTGGGGAGTGGACTCAAGATCATCT
GCATCAAAACGCCGCCGCCAAGCAATCTTGGGAAGCCACTTGGAGTTCATTGCGAGCGCCTTAGACGGGAAAATATCAGT
GGGATGCGAGACAGCAACCTGGAGGACTTATGTTTCCGGTGTTGTGAGTCTAATGGTGAGCTGTTTGCCGCTTTGGGTGG
CAGAGATTGATACAGAAGTGTTAAAAAGTCTGAGCAATGGACTAAGACAGTGGGGAAAAGACGAGCTAGCGATTGTATTA
CTCTCCTTGGGAGGTCTCAGAACAATGGATTACGCAGCGAATTTCATCATTCATTTGCGTTCATAG