Details for Capsella Locus Carubv10015667m

Position : scaf_3 ( 5`- 6415104 .. 6417704 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015667m

Protein [Map View]
MAVESIVMEIITDEWGRKSCISSPEESSIGPFFSNPSASELLFSSPSLSPPILSTVPHLTPARFLSVSGVPPSGSSAIAA
ASLSVPNPPDDTAKVLSYNRLQFLPFPSKNSVLVFFPTGTNLDRIGFLLLSTGDSGGLQVLGSDEGDVFVATERLFSRIL
KILVQPVSTFAADDSSSSVELGYVLVYSLYSIHWFCVNYDESQGKPVLRNLGCKQFKMCMVVSAAWSPHITGESLVLLEN
GEVFLFDVNQRLSRLRGSKLKVSWEGQGKSVNRRSWLGCDFGWTFGIYVVARSDAVFAIARSSENCTVRCLWEVESLNMA
ATEEVVGFAKAGSDCFRFILASQSYVFLCDSRSGVPLLKWQHDVEQPCFIDVYRLSELGIRTVESTTSCVIIGSFWNAQS
QMFCYGPSPSVVKDPCSLYVWELPHNLLLPVGKCLCGDCVFREVMMKESFLEWIDWQKKSVHVLGFGVLNKYLPLGSSDQ
SSGFTLVRLTSSGKLEAVTFCASPFKSLELVAHKDSACKPDEVNLLYLPDEDEYKFPRRFKYLELKYLSAHTKGMLAGFI
DSKLRTKSSGLQQNKSFSLICHEELCKKLKICGFGRDRSSSSITAVFENISSPTSIFEIALRETWSSLPIEILLLAFSNY
SEFEDVLVDKKKPSLEFLAVPEFPQLPPFLFRKPSSRSSKWSKKEQPGVELVGPVLPLPVLMTLHEFRNGCPNSEQEFSP
EAEFSNRCNQISKVTCELAISGQDETTISLGDDRGDEMWLNSDSQKEKKTFISYCPITKTTDSDRQQQELTTFVSRVRRC
KEGDNDAGGTTGLELFNELSPVDIYFENRKVNFDTKALLTSKTLLSQWQHRSSSYQEFLSQYHLKK*

DNA
ATGGCCGTGGAAAGCATTGTAATGGAGATTATTACAGATGAATGGGGACGCAAAAGCTGCATCTCCTCTCCCGAAGAATC
ATCTATTGGTCCTTTCTTCTCGAACCCATCAGCTTCGGAGCTACTCTTCTCTTCTCCCTCACTCTCTCCCCCGATTCTCT
CTACCGTCCCTCACCTTACTCCCGCGCGTTTTCTCTCCGTCTCCGGCGTCCCTCCGTCGGGCTCTTCCGCTATCGCCGCC
GCCTCTCTCAGTGTTCCCAATCCTCCCGATGATACCGCTAAGGTTCTCTCCTACAATCGCCTCCAGTTTCTACCTTTCCC
CAGTAAAAATTCAGTCTTGGTGTTTTTCCCCACAGGGACTAACCTTGATCGGATTGGGTTCTTGCTGCTTTCCACCGGAG
ATTCCGGTGGTTTACAAGTCCTGGGTTCGGACGAAGGTGACGTCTTTGTGGCGACAGAGCGATTGTTTTCTCGAATTTTG
AAGATTTTGGTGCAACCTGTTAGTACTTTTGCAGCGGATGACTCTTCTTCTTCTGTGGAATTGGGATACGTTTTGGTTTA
TTCCTTGTATTCGATTCATTGGTTCTGTGTCAACTATGATGAATCTCAAGGCAAGCCGGTTTTGAGAAACCTTGGGTGTA
AGCAGTTTAAGATGTGTATGGTTGTAAGCGCTGCTTGGAGCCCTCATATTACTGGAGAGTCGTTAGTCTTGTTAGAGAAC
GGAGAGGTCTTTTTGTTTGATGTGAATCAGAGACTTTCTAGACTTAGAGGTTCCAAACTGAAAGTTTCTTGGGAGGGTCA
AGGGAAATCAGTCAATAGGAGGAGTTGGTTAGGATGTGATTTTGGTTGGACTTTTGGGATTTATGTTGTTGCTCGCTCTG
ATGCAGTCTTTGCTATTGCCAGAAGCTCTGAGAATTGCACTGTGAGATGTTTATGGGAAGTTGAGAGTCTGAATATGGCT
GCAACAGAAGAGGTTGTTGGCTTTGCAAAGGCGGGTAGTGACTGTTTTAGGTTTATTCTCGCTTCCCAGAGCTATGTATT
TCTCTGTGATTCGAGATCAGGAGTGCCTTTGTTGAAATGGCAGCATGATGTTGAGCAGCCTTGCTTTATTGATGTTTATA
GATTGTCTGAACTTGGAATTAGGACTGTTGAATCAACTACTTCTTGCGTTATAATTGGCTCGTTTTGGAATGCGCAATCT
CAAATGTTCTGTTATGGACCTTCTCCATCTGTTGTGAAGGATCCTTGTTCCTTGTATGTATGGGAGCTTCCACACAATCT
TCTCTTACCTGTCGGAAAGTGTCTATGCGGAGATTGTGTATTTAGGGAAGTGATGATGAAGGAGTCTTTTCTCGAGTGGA
TCGACTGGCAGAAAAAGAGTGTTCATGTTCTCGGTTTTGGCGTTTTAAACAAGTACCTTCCACTTGGGTCGTCAGATCAA
TCTTCTGGGTTTACTTTGGTTCGGTTAACATCCTCGGGGAAGCTAGAAGCAGTCACATTCTGTGCTTCTCCTTTCAAAAG
TTTAGAACTAGTCGCTCACAAAGATTCGGCCTGCAAACCTGACGAGGTGAACTTACTGTACCTCCCTGATGAAGATGAAT
ACAAATTCCCGAGACGATTTAAATATCTCGAACTCAAGTATCTCTCTGCTCACACAAAAGGGATGCTAGCCGGGTTTATA
GATTCAAAGCTGAGGACAAAATCATCAGGTTTGCAGCAGAATAAATCTTTTAGCTTAATCTGCCATGAGGAATTATGTAA
GAAGTTGAAGATTTGCGGATTTGGTAGAGACAGATCTTCCTCTAGCATAACCGCAGTCTTTGAGAATATCAGTTCACCGA
CAAGCATTTTCGAGATTGCATTGAGAGAAACCTGGTCAAGCTTACCTATAGAGATTTTGTTGCTTGCATTCTCCAACTAC
TCTGAGTTTGAAGATGTTCTGGTAGACAAGAAGAAACCATCTCTCGAGTTCTTAGCTGTTCCAGAATTCCCACAGCTACC
GCCTTTCTTGTTTAGGAAACCTTCAAGCCGGAGTAGTAAATGGTCAAAGAAAGAGCAACCCGGTGTTGAGCTCGTTGGTC
CTGTTCTTCCACTTCCAGTTCTCATGACACTACATGAGTTTCGCAACGGATGTCCCAATTCAGAACAAGAGTTCTCGCCC
GAAGCAGAGTTCTCTAATCGATGCAATCAAATATCCAAAGTAACCTGCGAGCTCGCAATCTCAGGTCAAGATGAGACAAC
CATTTCACTTGGTGATGACCGAGGCGATGAAATGTGGCTTAACAGTGATTCACAGAAGGAGAAGAAGACTTTCATTTCAT
ATTGCCCGATTACAAAGACAACTGATTCAGACAGACAACAGCAAGAACTCACTACATTTGTCTCCAGAGTGCGTCGTTGT
AAAGAAGGTGATAATGATGCTGGAGGAACAACAGGTCTTGAACTGTTCAATGAGTTGTCTCCAGTCGATATTTACTTCGA
AAATCGGAAAGTGAATTTCGATACGAAAGCTTTGCTTACGTCCAAGACACTTCTCTCTCAATGGCAGCATCGATCATCTT
CATATCAAGAGTTTCTTTCTCAGTACCATCTAAAAAAATGA