Details for Capsella Locus Carubv10015656m

Position : scaf_3 ( 5`- 3698398 .. 3698922 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015656m

Protein [Map View]
LGKGFSAAPFNTFTIQSKAGTKGAYNLCKTSEVTVSSLEKTKQSCGEWKFALLELADSHYAAICTEDDQASGGAPMKVIV
RKTIPFVEDELISESKLL*

DNA
TTAGGAAAAGGCTTCTCTGCTGCACCTTTTAATACCTTCACAATCCAGTCTAAGGCTGGAACAAAAGGAGCCTACAATCT
TTGTAAGACATCTGAAGTGACGGTCAGTTCGCTGGAGAAGACAAAGCAAAGCTGCGGAGAATGGAAGTTTGCCCTCTTGG
AGTTGGCTGATTCTCATTATGCTGCAATCTGTACTGAAGATGATCAAGCTAGTGGAGGTGCTCCTATGAAGGTGATTGTC
CGAAAAACCATCCCCTTTGTAGAAGATGAACTTATTTCTGAATCCAAACTTCTGTAA