Details for Capsella Locus Carubv10015638m

Position : scaf_3 ( 5`- 400789 .. 401688 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015638m

Protein [Map View]
MEMITRGSGIPNGVVQVPKLLHQYFISSNHFCQRDHSDDQNGGEKKEEAAEEEEKDVELTLGLSLNGQFGTDPRSRKRNN
FELARSSSIPEGFFFHELRSAGGDMMQRRAEDMFQLDRTRSLPVVTEMETERKRMRSEKTRVFMESPVHPLSKDQNRAEV
EEEKARAFMEFKIPPTKEKEVKDGFVVPGPVNEKGKTGNTARKKKKKDAEVSGMEKARNILEDMPCVSTRDVGADGKRVE
GFLYWYGGNKEEVKIVCVCHGSFLSPAEFVRHGGCTVSDDDVTINPLKHIVVKLPSSSL*

DNA
ATGGAGATGATCACAAGAGGTAGTGGGATCCCCAACGGCGTCGTTCAGGTCCCGAAACTGTTGCACCAGTATTTCATCTC
AAGCAACCATTTTTGTCAACGAGATCACTCTGATGATCAGAATGGTGGTGAGAAGAAAGAAGAAGCTGCAGAGGAGGAGG
AGAAAGATGTCGAGCTCACGTTAGGTCTTTCCCTTAATGGACAGTTTGGTACGGATCCGAGATCGAGGAAAAGGAACAAC
TTTGAACTGGCCCGATCTTCTTCCATACCCGAAGGTTTCTTCTTCCATGAGCTAAGATCAGCCGGCGGAGATATGATGCA
GCGTAGAGCTGAAGACATGTTCCAGCTGGATCGGACGCGCTCGCTTCCTGTCGTAACGGAGATGGAGACAGAGAGGAAGA
GGATGCGATCGGAGAAGACGAGGGTGTTTATGGAATCTCCGGTTCATCCTCTGTCCAAAGATCAAAACAGAGCCGAGGTA
GAGGAAGAGAAGGCTAGGGCGTTTATGGAATTCAAGATCCCTCCGACGAAGGAAAAGGAAGTAAAAGATGGGTTTGTCGT
CCCTGGTCCGGTCAACGAGAAGGGTAAAACTGGAAATACGGCGAGGAAGAAGAAGAAGAAGGACGCGGAAGTTTCGGGAA
TGGAGAAGGCGAGGAACATCCTAGAAGACATGCCGTGCGTGTCGACGAGAGATGTCGGAGCCGACGGGAAACGAGTGGAA
GGGTTCCTATACTGGTACGGAGGGAACAAGGAGGAAGTCAAGATAGTCTGTGTTTGCCACGGCAGCTTTCTTTCTCCGGC
GGAGTTCGTTAGGCACGGTGGATGCACCGTCAGCGACGATGATGTTACGATAAACCCTCTTAAACATATTGTTGTTAAGC
TGCCTTCTTCTTCCTTGTAG