Details for Capsella Locus Carubv10015637m

Position : scaf_3 ( 5`- 6679616 .. 6682079 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015637m

Protein [Map View]
MPRPFFHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKADNKIWFQDGWQEFVDRYSIRIGYLL
IFRYEGNSAFSVYIFNLSHSEINYHSTGLMDSAHNHFKRARLFEDLEDEDAEVIYPSSLYPSTLPESTVQANKGYTGSAI
QSLFSGSVKAEESMPTPKIPKKRGRKKKNADPEEINSSAPRDDDPENRSKFYESASARKRTVTAEERERAINAAKTFEPT
NPFFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKVQLAEKQWPVRCLYKAGRAKFSQGWYEFTLENNLGEGDVCVF
ELLRTRDFVLKVTAFRVSEYV*

DNA
ATGCCACGCCCTTTCTTCCATAAGTTGATTTTCTCATCTACTATCCAAGAAAAGCGTCTGAGAGTCCCAGATAAGTTTGT
GAGTAAATTCAAGGATGAGCTTTCGGTTGCTGTTGCACTCACAGTACCTGATGGTCATGTTTGGCGTGTAGGACTAAGGA
AAGCTGACAACAAAATTTGGTTTCAAGATGGTTGGCAAGAGTTTGTTGACCGTTACTCCATTCGCATTGGTTATCTTTTG
ATTTTTAGATATGAAGGAAACTCTGCCTTCAGCGTCTACATTTTCAATTTATCACACTCTGAAATCAATTACCATTCAAC
CGGTCTCATGGATTCCGCACACAACCACTTCAAACGCGCCCGTTTATTTGAAGACCTTGAAGATGAAGATGCCGAGGTCA
TCTATCCTTCTTCCTTGTACCCATCAACACTTCCTGAGTCTACAGTACAAGCCAATAAAGGGTATACTGGTTCAGCCATC
CAAAGCTTATTCTCTGGATCTGTTAAAGCTGAAGAATCAATGCCAACCCCAAAAATTCCGAAAAAGAGAGGGAGGAAGAA
GAAAAATGCTGATCCTGAGGAAATAAACTCATCTGCTCCTCGCGATGATGACCCAGAGAACCGTTCAAAGTTCTACGAGA
GTGCTTCTGCTAGAAAGAGAACCGTGACTGCAGAAGAAAGAGAGAGGGCCATCAATGCAGCCAAAACGTTCGAGCCAACA
AACCCTTTCTTCAGAGTTGTCCTGCGACCATCCTATCTATACAGAGGCTGCATCATGTATCTTCCTTCGGGGTTTGCTGA
GAAGTACCTAAGTGGGATCTCTGGGTTCATCAAGGTCCAGCTGGCGGAGAAACAATGGCCTGTACGATGTCTCTACAAAG
CTGGGAGAGCCAAATTCAGTCAAGGATGGTACGAGTTTACTCTGGAGAACAACCTAGGAGAAGGAGACGTGTGTGTGTTC
GAGCTGCTCAGAACCAGAGATTTCGTTCTGAAAGTAACGGCCTTTCGAGTCAGTGAGTACGTCTGA