Details for Capsella Locus Carubv10015636m

Position : scaf_3 ( 5`- 3302036 .. 3305046 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015636m

Protein [Map View]
MRALNSRLVLIDINSSWQASRRLISATTTAFSSDSSSSFRRTRGARQRIASSKSPASSPSPVRKPSDGLSFDLRSPSADS
YNSASISSRRTSSTAPPTVELDAFLDILPPTTRKELVKHEAIEDLIEVVMDLGRKPLARFPSGDWVISEQPVTHQDLELA
VSKVGDFSDDNRSGIDRSLHRISAIRNRKLQVIGLTCRVGRAVSGSAEIIRDLIEGGGSILVIGSPGVGKTTLIREIARM
LADEHRKRVVIVDTSNEIGGDGDVPHSGIGRARRMQVPNVNLQHDVMIEAVENHMPETIIIDEIGTELEALAASTIAQRG
VQLVATAHGMTIDNIIKNPSLQILIGGIESVTLGDEEARKRKVQKTILERKGPPTFTCAVEMISRTECRVHQKLDITVDA
ILAGKSAPFEIRQIRGDDDVPHKLVTPVPLETLEEEPAPLLNRDFVSEVLSDDEDEGYLPIQYNKASSNTYTSPRSSPVH
VYTYNVLEADLLQVAEVMGLDDEIEVTDDVGEADVILASSSELKQNSSIRRVAKLHKLPIFVIKSTTMAQMVKAVRMILG
RESFGSAPKTIEKSSVDDIEIKDDAPESKPSLEELDALEEVRLAIEYIVIPGGEPVELLPRRSDIIVRQLELVESYQLAV
ENLGTHLNPRLQILPRRSTKKMLPSSSSKRATEDSMGNTITRLPFLKD*

DNA
ATGAGGGCGTTGAATTCGCGGCTAGTTCTGATCGACATCAACAGCTCATGGCAAGCTTCGCGCCGGTTAATCTCCGCCAC
CACAACCGCTTTTTCATCCGATTCCTCCTCCTCATTCCGTCGAACACGTGGTGCGCGTCAGAGGATCGCTTCGTCGAAGT
CTCCGGCGTCGTCGCCGTCTCCTGTTCGGAAACCATCTGATGGACTCAGCTTCGATCTTCGGTCACCGTCAGCTGATTCG
TATAATTCCGCGTCGATCTCATCTCGAAGGACATCGTCGACGGCTCCGCCTACGGTGGAGCTCGACGCTTTCCTCGATAT
TCTCCCTCCGACGACTAGGAAAGAGCTCGTTAAGCACGAGGCGATCGAGGATTTGATCGAAGTGGTGATGGATTTAGGGA
GGAAGCCATTAGCTAGATTCCCTTCCGGCGATTGGGTGATCTCAGAGCAGCCTGTGACCCACCAGGATCTGGAACTTGCA
GTATCAAAGGTTGGTGATTTTTCGGATGATAACAGATCGGGGATCGACAGATCTTTGCATCGTATAAGCGCTATACGTAA
TCGCAAACTTCAAGTAATTGGTCTAACATGTCGAGTGGGTCGAGCTGTATCTGGAAGTGCAGAAATTATAAGAGATTTGA
TTGAAGGAGGAGGATCCATCTTGGTCATAGGATCTCCCGGAGTTGGCAAAACAACTTTAATCAGAGAAATTGCACGGATG
TTAGCTGATGAACACAGAAAACGTGTAGTGATTGTTGACACGTCAAATGAGATTGGAGGTGATGGTGACGTTCCCCATTC
TGGAATTGGCCGTGCCAGGCGGATGCAAGTTCCAAATGTGAATTTACAACACGATGTGATGATTGAGGCGGTTGAGAATC
ATATGCCTGAGACTATCATCATCGATGAGATAGGGACTGAGCTTGAAGCTTTAGCTGCTAGCACTATTGCTCAACGAGGT
GTTCAGCTTGTTGCAACTGCTCATGGGATGACTATAGACAACATTATCAAAAATCCTTCTTTGCAGATTCTTATTGGTGG
AATTGAGAGTGTGACTCTTGGTGATGAAGAAGCAAGGAAAAGAAAAGTGCAGAAGACAATTCTTGAAAGAAAAGGACCTC
CGACATTTACTTGTGCTGTAGAGATGATTTCGAGAACTGAGTGTCGTGTTCATCAAAAATTAGATATCACCGTTGATGCT
ATACTAGCTGGGAAATCCGCTCCATTTGAGATCCGTCAAATTCGTGGCGATGATGATGTTCCTCATAAGTTAGTGACTCC
CGTTCCTTTGGAGACCCTTGAAGAGGAGCCTGCACCATTGCTCAACAGAGATTTCGTAAGTGAAGTGCTGTCTGACGATG
AAGATGAAGGTTATCTTCCCATTCAGTATAATAAGGCCAGTAGTAACACATACACAAGCCCAAGAAGCTCGCCGGTTCAT
GTTTATACTTACAATGTCCTTGAAGCTGATCTCCTTCAAGTAGCTGAAGTTATGGGCTTAGACGACGAAATAGAAGTGAC
AGATGATGTTGGAGAAGCAGATGTCATTCTAGCATCAAGTTCTGAATTGAAACAGAACTCATCGATCCGTCGTGTTGCCA
AATTACACAAGCTACCGATATTTGTTATTAAGTCAACTACAATGGCTCAGATGGTCAAGGCGGTCCGAATGATCCTTGGG
AGAGAATCATTTGGCTCAGCCCCTAAAACCATAGAGAAATCTTCTGTTGATGATATTGAGATCAAAGATGATGCTCCTGA
AAGCAAACCCAGTTTAGAAGAACTCGATGCCCTCGAGGAAGTCCGTCTAGCAATCGAATATATTGTAATCCCGGGAGGTG
AACCAGTGGAGCTTCTTCCGAGACGGTCAGATATAATAGTTCGGCAGCTAGAGCTGGTTGAGAGTTACCAACTCGCAGTT
GAGAACCTCGGCACTCACCTTAATCCGCGCCTTCAGATACTTCCTCGCCGATCAACCAAGAAGATGTTGCCATCTTCCTC
TTCAAAGAGAGCAACAGAAGATAGCATGGGGAATACCATTACTCGTCTTCCTTTCCTTAAGGATTGA