Details for Capsella Locus Carubv10015621m

Position : scaf_3 ( 5`- 5725803 .. 5728666 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015621m

Protein [Map View]
MYRTAASRAKSLKGILTRNLPASRYASSSAVATGSSSSPGLFSWLTGGSSGSLPPMDIPLAGVSLPPPLADHVAPEKLKI
TTLSNGLKIATEMSSNPAASIGLYVDCGSIYEMPYCRGATHLLERMAFKSTLNRSHFRLVREIEAMGGNTSASASREQMG
YTIDALKTYVPEMVEVLIDSVRNPAFLDWEVNEELRKVNVEIGELAKNPMGFLLEAVHSAGYSGALANPLYAPESVALTG
DVLEEFVSENYTAARMVLAASGVDHEELLKVVEPLLSDLPNVTRPAEPKSQYVGGDFRQHTGGDATHFALAFEVPGWDNE
KEAIVATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEHPEVQSCTAFTSVFNNTGLFGIYGCTSPDFASTGIALVADE
MKAVAEGRVNQKHLDRAKAATKSAILMNLESRMIAAEDIGRQILTYGERKPVDEFLKTIDQLNLKDIADFTSKVIAKPLT
MASFGEVLNVPSYESVSKRFH*

DNA
ATGTACCGCACGGCAGCTTCACGAGCTAAGTCCCTTAAGGGCATTCTTACCCGCAATTTGCCGGCTTCTCGGTATGCAAG
CTCTAGTGCTGTTGCAACGGGCTCTTCTTCGTCACCGGGTCTTTTCAGCTGGCTAACTGGAGGCTCCTCTGGTTCGCTTC
CTCCGATGGACATTCCCTTGGCTGGTGTCTCACTTCCACCACCACTCGCCGATCATGTTGCGCCTGAAAAACTTAAGATC
ACTACTCTTTCCAATGGTCTCAAAATAGCCACTGAGATGTCTTCGAATCCTGCGGCCTCCATTGGTTTATACGTTGATTG
TGGTTCGATTTATGAGATGCCTTATTGCCGTGGAGCTACACACTTGCTTGAAAGGATGGCTTTCAAGAGTACGTTGAACA
GAAGCCATTTTCGCCTTGTAAGGGAAATTGAGGCTATGGGAGGTAATACTTCAGCCTCTGCATCCCGAGAGCAGATGGGT
TACACAATCGATGCTCTCAAAACCTATGTTCCTGAAATGGTTGAAGTGCTTATCGATAGTGTGAGGAACCCTGCTTTCTT
GGATTGGGAAGTGAATGAAGAGCTTCGAAAAGTGAATGTGGAGATTGGAGAACTTGCAAAGAATCCTATGGGCTTTCTCT
TGGAGGCGGTTCATTCTGCTGGTTACTCTGGCGCTTTGGCAAATCCGTTGTATGCACCTGAATCTGTTGCATTGACTGGG
GACGTCTTGGAGGAGTTTGTTTCTGAGAATTACACTGCTGCACGAATGGTACTAGCAGCTAGTGGAGTTGATCATGAAGA
ACTTCTTAAAGTGGTTGAGCCATTACTTTCTGACCTTCCTAATGTAACCCGACCAGCGGAGCCAAAGTCTCAATATGTCG
GTGGAGATTTCCGTCAACATACTGGTGGAGATGCTACACATTTTGCGCTTGCTTTTGAAGTGCCAGGATGGGATAACGAG
AAGGAAGCTATTGTTGCAACTGTTCTTCAGATGCTTATGGGAGGAGGTGGCTCATTCTCTGCGGGAGGCCCTGGAAAGGG
GATGCACTCTTGGCTCTATCTTCGCATTTTGAACGAACATCCGGAGGTTCAGTCATGCACTGCATTCACTAGCGTCTTTA
ACAATACCGGATTATTTGGAATCTATGGTTGCACGAGTCCTGACTTTGCTTCAACAGGAATTGCATTAGTAGCTGATGAA
ATGAAAGCTGTTGCTGAAGGACGAGTTAATCAGAAACATCTTGATCGCGCCAAGGCAGCAACGAAATCTGCGATTCTGAT
GAATCTGGAATCTCGGATGATTGCAGCAGAAGACATAGGTAGACAGATACTTACATATGGAGAGAGGAAACCAGTTGATG
AATTCTTGAAGACAATAGACCAACTCAACTTAAAGGACATTGCAGATTTCACTAGCAAGGTTATTGCAAAGCCTTTGACG
ATGGCATCTTTCGGAGAAGTGTTGAATGTTCCAAGCTATGAGTCCGTAAGCAAAAGATTTCATTGA