Details for Capsella Locus Carubv10015619m

Position : scaf_3 ( 5`- 6114850 .. 6116070 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015619m

Protein [Map View]
MRSELTRETKLIFDLPQDVIEEIFSKVPVASLRRLRPTCKRLNALPKNQGIIKKHFEKRQYHALMLLNFKFYSVSYNLHG
VNEDIASLLELSLIDPHRGTDADISQAFHCDGLLLCTTKENRLVIWNPFSGQTRWLQPQNRGKIDEAYVLGYDNTDLCHS
YKILSFPDIYYQELDTSQNSWRDLDVTPQGDLDLKTEEFSSNSWRRHLGVTPQGDLHLKIYDFSSSSWKNLDVITPEGCL
KSCGVSVKGNAYWVYVSKQRGVNDYSLLSFDFSTEIFQHLCVPFNQEADCADTTALSVVKDEHLSLLYQSCETLKVEIWM
TNKIETTFVSWRKFLTVDIEPQIPMFSCRMSFFVIEDMKVAVCCDRDNKVYVIREDEYKVSSGFYFLDFEGITCCLTVFG
YVPRLV*

DNA
ATGAGATCAGAACTCACAAGAGAAACAAAGTTGATCTTCGATCTTCCACAGGATGTGATAGAAGAGATATTCTCTAAGGT
TCCGGTGGCATCTCTAAGAAGATTACGACCTACTTGCAAAAGATTGAACGCTTTACCCAAAAATCAGGGCATCATCAAAA
AACATTTTGAGAAAAGGCAGTACCATGCTCTTATGCTGCTCAACTTTAAGTTTTATTCGGTAAGCTACAATCTCCATGGA
GTTAATGAGGATATCGCTTCCTTGCTTGAACTTAGCCTAATCGATCCCCATCGTGGTACAGACGCCGATATATCTCAAGC
CTTTCACTGCGATGGTTTATTGCTATGCACCACCAAAGAAAATAGATTAGTGATTTGGAATCCGTTTTCGGGGCAAACCA
GATGGTTACAACCGCAAAATCGTGGCAAGATAGACGAAGCCTATGTTCTTGGGTACGACAACACCGACTTGTGCCATAGC
TACAAAATCTTGAGTTTTCCGGATATTTACTACCAAGAATTGGATACTAGCCAAAATTCTTGGAGGGATCTTGATGTCAC
ACCCCAAGGCGACTTAGACTTGAAAACCGAAGAGTTTAGCTCTAATTCATGGAGGAGACATCTTGGTGTTACTCCCCAAG
GCGACTTACATTTGAAAATATATGACTTTAGCTCTAGTTCATGGAAGAATCTTGATGTCATTACTCCCGAAGGTTGCTTA
AAATCTTGTGGCGTGTCCGTGAAGGGAAATGCTTATTGGGTGTACGTGTCTAAGCAAAGAGGAGTCAACGACTACTCTCT
ACTTAGTTTCGATTTTTCAACTGAGATTTTCCAACATTTGTGTGTTCCCTTTAATCAAGAAGCAGATTGTGCTGATACTA
CGGCTCTCTCGGTTGTTAAAGACGAACATCTTTCGTTGTTATATCAGAGCTGCGAGACGCTAAAGGTGGAAATATGGATG
ACCAACAAGATCGAGACCACATTTGTGTCATGGAGGAAGTTCCTAACAGTGGATATAGAACCTCAGATCCCTATGTTCTC
GTGTCGGATGAGCTTCTTCGTTATAGAGGATATGAAAGTTGCCGTGTGTTGTGACAGAGATAACAAAGTATATGTTATTA
GAGAAGATGAATACAAAGTATCTTCCGGTTTTTATTTTTTAGATTTCGAAGGCATAACATGTTGCTTAACTGTCTTTGGT
TATGTTCCAAGATTGGTTTAA