Details for Capsella Locus Carubv10015618m

Position : scaf_3 ( 5`- 2323691 .. 2326604 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015618m

Protein [Map View]
MDRVKKLHSTCCKRTASLGQVGNCIRSFQPLKDHSTQGTLQSILVAGARTLQIKPGFQTDLASFRKLLRLQSLFCQFPFL
FDQIGEFHGMATAIGGGSDVEVGFAKLQGEDFEYFMQSYSIMLGRNSKKSTVDVDLSSLGGGMNISRNHARIFYDFTRRR
FSLEVLGKNGCFVEGVLHLPGNPNVKLDSQDLLQIGDKEFYFLLPVRSILGGPLGPRHHVSGQTSVVPYHNYHSGSGRKG
VRSRELYESDDDEGEDDEDDEEDIRGSGKKTRRDGHEVYASGEKKREGRAKVDREADDQQVLQLEEKDVVSSVATVLSDL
CGPGEWMPMEKLHSMILKEYGNVWHHSRVRRYLTQEDWAIPEAKGKPWYGLLMLLRKYPEHFVINTRSKGRVTLEFVSLV
SLLS*

DNA
ATGGACAGAGTAAAGAAACTACATAGTACATGCTGCAAGAGGACTGCTTCTCTAGGACAGGTAGGAAACTGCATTAGATC
ATTCCAACCATTAAAAGACCATAGCACCCAAGGGACACTACAAAGTATATTGGTAGCTGGTGCAAGGACACTACAAATTA
AACCGGGTTTCCAAACAGATCTTGCCTCGTTTCGGAAATTATTACGATTGCAATCCCTATTTTGCCAATTCCCGTTCCTC
TTTGATCAAATCGGAGAATTTCACGGCATGGCTACGGCTATTGGAGGCGGAAGCGATGTGGAGGTCGGATTTGCGAAGCT
GCAAGGCGAGGATTTCGAGTACTTTATGCAGTCATACTCCATTATGCTCGGCCGGAATTCTAAGAAATCCACCGTCGACG
TTGATCTCTCATCCCTCGGCGGCGGGATGAACATTTCGCGCAACCACGCTCGGATCTTCTATGACTTCACTAGACGACGC
TTCTCTCTCGAGGTCCTTGGTAAAAATGGTTGCTTCGTTGAAGGTGTCCTCCATCTCCCTGGGAACCCTAACGTCAAGCT
CGACTCACAGGACCTTTTGCAGATTGGTGACAAAGAGTTCTACTTTCTCCTTCCGGTTCGGAGCATTTTAGGCGGCCCGT
TGGGACCTAGGCACCACGTCTCAGGGCAGACTAGTGTTGTTCCGTACCATAATTATCATTCGGGTTCGGGTAGAAAAGGC
GTCCGGAGTAGAGAGTTGTACGAGTCTGACGATGATGAAGGTGAAGATGACGAAGATGATGAGGAGGATATCAGAGGCAG
TGGAAAGAAAACAAGGAGAGATGGACATGAAGTATATGCTTCCGGAGAGAAGAAGAGAGAGGGAAGAGCAAAGGTAGACC
GTGAAGCTGATGATCAGCAAGTTCTGCAGCTGGAGGAAAAAGATGTTGTATCATCTGTTGCCACTGTGCTTTCTGACTTG
TGTGGTCCGGGAGAGTGGATGCCTATGGAAAAACTTCATTCTATGATATTAAAGGAGTATGGAAACGTATGGCATCACAG
TCGAGTAAGAAGATACCTGACACAAGAAGACTGGGCTATCCCTGAAGCAAAGGGTAAACCATGGTATGGTTTGCTGATGC
TACTGAGAAAATATCCGGAGCATTTCGTTATCAACACTAGATCTAAGGGAAGAGTCACCCTTGAATTTGTTTCTCTCGTT
TCTCTACTCTCATGA