Details for Capsella Locus Carubv10015617m

Position : scaf_3 ( 5`- 6007627 .. 6008148 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015617m

Protein [Map View]
MAAYLMNRVFVSSLMLSVMIGSLNAQVADIKAICGKAKNQSFCSSYMKSNPKTSGADLPTLANITFGSAQTSASEGFNRI
QSLVKAATNPTLKKAYTSCVQHYKSAISSLNDAKQSLASGDGPGLNIKVSAAMEGPTTCEEDMANFKVDTSTMYNSGDFQ
NICGIVLVISNMM*

DNA
ATGGCAGCATACCTAATGAACAGAGTTTTTGTGTCTTCTCTGATGCTTTCCGTAATGATTGGTTCCTTGAACGCACAAGT
GGCAGACATAAAAGCAATCTGCGGTAAAGCGAAAAACCAATCCTTCTGTTCGAGCTACATGAAATCCAACCCGAAGACAT
CGGGTGCTGATCTTCCAACACTTGCAAATATCACCTTTGGTTCTGCACAAACAAGTGCATCAGAAGGTTTCAATAGAATT
CAATCTCTAGTCAAGGCAGCAACCAACCCAACTTTGAAGAAAGCATACACCTCGTGCGTACAGCATTATAAGAGTGCAAT
CAGCAGTCTCAATGATGCTAAGCAGAGCCTTGCGTCAGGCGATGGTCCAGGGTTGAACATTAAGGTATCAGCGGCTATGG
AAGGACCTACAACATGTGAAGAAGACATGGCAAATTTCAAAGTTGACACTTCAACTATGTATAACAGTGGTGACTTTCAG
AATATTTGTGGCATTGTTCTTGTCATCTCGAACATGATGTGA