Details for Capsella Locus Carubv10015615m

Position : scaf_3 ( 5`- 2458083 .. 2458669 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015615m

Protein [Map View]
MQQKILLRVAMTDDKTRAKALTTAVRFKGVNAVEIKGDHRNQVEVTGVEVDMIVLINTLRKKVAFAELVSVAKVEPPKDG
DKKPDEKKTEEKKPEPCCQPWHYGYGVPSSYYCPCDKKPDKKETEEKKPEPCYQPWPYGYGVPSSYPYPCDPYHQTGEPV
YNHDPNCRIM*

DNA
ATGCAGCAAAAGATCCTGCTAAGAGTTGCTATGACTGATGACAAAACCCGAGCAAAAGCACTGACAACTGCTGTTCGGTT
TAAAGGCGTGAACGCTGTGGAAATAAAGGGAGATCACAGGAACCAGGTTGAGGTGACCGGTGTTGAAGTCGATATGATCG
TTCTAATCAACACACTGAGGAAAAAAGTAGCATTTGCAGAGCTTGTTAGCGTAGCGAAAGTTGAACCACCAAAAGATGGT
GACAAAAAGCCAGATGAGAAGAAAACTGAAGAGAAAAAACCCGAGCCATGCTGTCAACCATGGCATTATGGATATGGTGT
GCCATCTTCCTATTACTGCCCATGTGACAAAAAGCCGGATAAGAAGGAAACTGAAGAGAAAAAACCCGAGCCATGCTATC
AACCATGGCCTTATGGATATGGTGTGCCATCTTCCTATCCTTACCCGTGTGATCCTTACCATCAGACTGGGGAACCCGTA
TACAATCATGATCCCAACTGCAGGATCATGTGA