Details for Capsella Locus Carubv10015614m

Position : scaf_3 ( 5`- 1948539 .. 1950128 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015614m

Protein [Map View]
MDDASSSYGLNKGLSPPSSSSARSIADSVDYDFYSDKEEMGDKRKKTFMFIRLVSAAGTGFFYVKRKSTKGLLEKLEFRK
YDPRVNRHVLFTEQKMK*

DNA
ATGGACGATGCATCATCGTCATATGGTTTGAACAAAGGTTTATCACCCCCGTCATCTTCGTCGGCGAGATCAATTGCGGA
CTCCGTCGATTACGATTTTTACAGTGATAAAGAAGAAATGGGTGACAAGAGGAAGAAGACGTTCATGTTCATCCGTCTAG
TATCAGCAGCTGGGACTGGATTCTTCTACGTCAAGAGGAAGAGTACCAAGGGACTTCTTGAGAAGCTCGAGTTCCGTAAG
TACGATCCTCGAGTTAATCGCCATGTCCTCTTTACTGAGCAGAAAATGAAGTGA