Details for Capsella Locus Carubv10015608m

Position : scaf_3 ( 5`- 7638482 .. 7639501 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015608m

Protein [Map View]
MKPIQSPPGVSSPMKNRLRKRPDLSLPLPLRNVALAVPLPLPPPSSSSSAPASSSGTQTNSLSELERVNRIGSGAGGTVY
KVIHRPTSRAFALKVIYGNHEETVKRQICREIKILHSVDHPNVVKCHEMYDNNGEIQVLLELMDQGSLEGAHVWQEEELA
HLSRQILSGLAYLHRRHIVHRDIKPSNLLINSAKTVKIADFGVSRILAQTMDPCNSSVGTIAYMSPERINTDLNHGRYDG
YAGDVWSLGVSILEFYLGRFPFAVSRQGDWASLMCAICMSQPPEAPPTASQEFRHFVSCCLQIDPPKRWSAQQLLQHPFI
LKSTGGPTLRQMLPPPPAS*

DNA
ATGAAACCGATTCAATCGCCTCCTGGAGTATCTTCACCTATGAAGAACCGTTTACGGAAACGTCCTGACCTAAGCTTACC
ACTCCCACTCCGCAACGTCGCTCTCGCTGTACCTCTCCCTCTCCCACCTCCCTCCTCCTCCTCCTCTGCTCCGGCGTCTT
CATCTGGCACCCAAACCAACAGCTTGTCCGAGCTAGAACGAGTGAACCGAATCGGAAGCGGAGCCGGAGGGACGGTTTAC
AAAGTAATCCACCGTCCGACGTCGCGTGCCTTCGCTCTCAAAGTGATTTACGGAAACCACGAAGAGACTGTGAAACGACA
GATCTGTAGAGAGATCAAGATCTTGCATAGCGTGGATCATCCTAACGTTGTGAAATGTCACGAGATGTATGATAATAACG
GCGAGATCCAGGTTTTGCTTGAGTTGATGGATCAAGGATCTCTTGAAGGAGCACATGTCTGGCAAGAAGAGGAATTAGCT
CATCTCTCTCGCCAGATTCTTAGTGGATTAGCTTACCTTCACCGCCGTCACATCGTTCACCGTGATATCAAACCCTCCAA
TCTTCTCATTAACTCGGCTAAGACTGTCAAAATCGCTGATTTTGGAGTGAGTCGGATCTTGGCTCAAACCATGGATCCTT
GTAACTCCTCTGTTGGCACTATTGCTTATATGAGTCCTGAGAGGATCAACACTGATCTGAACCATGGCCGTTACGATGGT
TACGCCGGAGATGTATGGAGCTTAGGTGTTAGCATCTTGGAGTTTTACTTGGGGAGGTTCCCTTTTGCTGTGAGTAGACA
AGGGGACTGGGCCAGTCTAATGTGTGCCATTTGTATGTCTCAGCCACCTGAAGCTCCTCCCACGGCGTCTCAGGAGTTTC
GTCACTTTGTTTCTTGTTGCTTGCAGATTGATCCTCCTAAGAGATGGTCAGCTCAACAGCTTTTGCAACATCCTTTCATT
CTTAAATCTACCGGTGGTCCTACTCTCCGTCAAATGTTGCCGCCGCCTCCTGCCTCCTAG