Details for Capsella Locus Carubv10015597m

Position : scaf_3 ( 5`- 5971048 .. 5971599 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015597m

Protein [Map View]
MKRSSSTITSLPCLSLFLLLLLPSVYSDDDLIDKICQATPFCDLCEASLRPLSPSPSDPKSLAAAMASVVLGNMTDTLGY
IQSLIRHSHDPAAERALAQCAELYRPVVKFNIPQAMEAMRRGKFGLAIYVLGDAEKQTDSCQKGITNAGADDESSVALTA
RNKLVKNLCDVAMSVIKSLLNGL*

DNA
ATGAAGAGATCATCCTCCACCATCACATCATTACCGTGTCTCTCTCTCTTTCTCCTCCTGCTTCTGCCGTCAGTATACTC
CGACGATGATCTTATCGACAAAATATGCCAAGCAACGCCGTTCTGCGACCTCTGTGAAGCCTCTCTCCGTCCACTCTCCC
CCTCACCTTCCGATCCCAAATCTTTAGCGGCAGCTATGGCTAGCGTCGTGCTCGGTAACATGACCGATACACTAGGATAC
ATCCAATCTCTGATCAGACATTCTCACGATCCTGCGGCAGAGCGAGCGCTGGCTCAGTGCGCCGAGCTGTACCGGCCGGT
GGTCAAGTTTAATATTCCTCAGGCGATGGAAGCAATGCGGCGCGGCAAGTTCGGACTGGCGATATACGTCCTCGGAGACG
CGGAGAAGCAGACTGATTCCTGCCAGAAAGGGATCACAAACGCCGGCGCGGACGACGAGAGCTCGGTGGCCCTTACCGCT
AGAAACAAGCTGGTAAAGAATCTTTGTGACGTGGCGATGTCTGTGATTAAGTCTCTGCTGAATGGTCTTTGA