Details for Capsella Locus Carubv10015596m

Position : scaf_3 ( 5`- 8185192 .. 8189339 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015596m

Protein [Map View]
MVGGNNNAKPSTNKPPPATPAPTAAASSSQNRKSRWNANSNDGGTSNNNNNKESKPTTGGQKIADKKLPRPNPSPKLAPI
PNQSNSNHPNPAAPTSSRPMAPFPFPDSSLAAALGPPPPPTYGTHMLERRTIVLADGSVRSYFALPPNYQDFPPPSRVAG
PEFGRFPPYHPEEFRDQRNHWDRPEGSMKRKYPGEEEFDRRDERAEMLRQRQHFMQYANPNDHSVMAGTSGQFGDDGRPA
KHMRTGSSRHESGGLQVDQVALKKSFLSFVKRVFEDPAEKKNYLENGRKGRLRCLVCGRSSRDVQDTHSLVMHTYCSESS
DDASSRVHHLGLHKALCVLMGWNFTKAPDITKAYQNLPAEEAAINQAQLIIWPPHVIVHNTSTGKGKEGRMEGFGNKTMD
NRIRELGLTGGKSKSLYGRDGHLGITLFKFAGDDSGLREAMKMADHFEKMNRGRKSWGRIQPFTPSKDDEKNHSLVEVDG
RTGEKKRILYGYLATVADLDKVDMETKKKTTVESLRELTGTK*

DNA
ATGGTTGGTGGCAACAACAACGCTAAACCGTCGACGAACAAGCCTCCTCCGGCGACACCCGCTCCCACCGCTGCAGCTTC
GTCTTCACAGAACCGTAAATCCCGTTGGAATGCGAATAGTAACGATGGCGGAACCAGTAACAACAACAATAACAAAGAAA
GCAAACCGACGACGGGAGGCCAGAAAATCGCCGATAAGAAGCTCCCGAGGCCGAATCCTTCTCCAAAGCTAGCTCCTATT
CCGAATCAATCCAATTCGAATCATCCAAATCCAGCAGCTCCGACATCTTCACGGCCGATGGCTCCGTTTCCTTTCCCTGA
TTCGTCGTTGGCAGCAGCGCTTGGTCCTCCTCCTCCACCGACTTATGGAACCCATATGCTGGAGCGGCGCACAATTGTTC
TAGCTGATGGTAGTGTCCGTTCCTATTTCGCACTTCCTCCTAATTACCAGGATTTTCCTCCTCCAAGCCGAGTAGCTGGA
CCGGAATTTGGGCGATTCCCACCCTATCACCCTGAAGAGTTTCGAGATCAGAGGAATCACTGGGATCGGCCTGAGGGTTC
GATGAAACGGAAGTATCCAGGTGAAGAGGAATTTGATAGGAGAGATGAGAGGGCTGAAATGCTGAGACAAAGACAACATT
TTATGCAGTATGCGAATCCTAATGATCACTCAGTTATGGCTGGTACGAGTGGTCAGTTCGGAGACGATGGTAGACCAGCT
AAGCATATGCGGACAGGATCAAGTAGGCATGAAAGTGGAGGTCTCCAGGTTGACCAGGTTGCACTAAAGAAATCGTTTTT
GAGTTTTGTTAAGCGAGTTTTCGAGGACCCAGCTGAGAAGAAGAACTACTTGGAGAACGGGAGAAAAGGGCGGCTTCGAT
GTCTCGTTTGTGGCAGGTCTTCTAGAGACGTCCAGGATACCCATAGTTTGGTAATGCACACATACTGTTCTGAATCTTCT
GACGATGCTAGCTCACGTGTGCATCACTTAGGCCTACACAAAGCTCTCTGTGTATTGATGGGTTGGAATTTCACAAAGGC
TCCTGATATTACAAAGGCATACCAGAATCTACCTGCTGAAGAGGCAGCAATCAATCAAGCACAGCTGATTATTTGGCCAC
CTCATGTGATTGTTCATAATACCAGTACAGGGAAGGGTAAAGAAGGGCGCATGGAAGGCTTTGGAAACAAAACAATGGAT
AACAGAATCAGAGAACTAGGACTCACTGGTGGGAAATCAAAGTCACTGTATGGAAGAGATGGTCATTTGGGAATTACCCT
GTTCAAGTTTGCGGGTGACGATTCAGGGCTTAGGGAAGCTATGAAAATGGCAGACCATTTTGAGAAGATGAACCGTGGGC
GTAAGAGTTGGGGCAGAATACAACCATTTACTCCAAGCAAAGATGATGAGAAAAACCATAGTCTTGTCGAGGTTGATGGT
AGGACGGGTGAGAAAAAGAGAATCCTTTATGGTTATCTTGCGACCGTAGCAGACTTGGACAAAGTCGATATGGAGACAAA
GAAGAAGACCACAGTTGAGAGCCTTAGAGAACTCACAGGAACTAAGTAA