Details for Capsella Locus Carubv10015595m

Position : scaf_3 ( 5`- 2285220 .. 2286317 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015595m

Protein [Map View]
MSALKSRSNSLAGLSLDAVLGGEIIIQPSSPPSPPPLPSKSLVPHHPTSQTLFDIIREEYAKEGHKDRTTWQIFREKLRL
KRTGSAWTSSLLIPASDILIPNPKHLGTAFRSQSAGLANVNIRELVNVIPMSDPPGSSGRAMFTRGSSMRVGSSKNPDDS
PDINILGDGPPSRSFKPQLSRHDSVRDHSDGEEDTRRRHPIVTFVEERQMSAREAVAAQEAAEAEAAAAGGSEDEDDDDD
NEEDDSGETEEKKSSSASAPKQTMSLMDLLEETDRQMGLTGSRYAMDDDEEYEEDEEDENYEEEGDGHDGGEGELSCCAC
MVKIKGASFTPCGHTFCKLCSKELMAQKGHCPVCSSFVVEFLEIF*

DNA
ATGTCGGCGTTAAAGAGCCGTAGTAACTCGTTAGCCGGACTAAGTCTAGACGCTGTGCTTGGCGGCGAGATCATTATACA
ACCGTCATCTCCACCGTCGCCACCACCTTTGCCATCAAAATCTCTTGTGCCCCACCACCCAACAAGCCAAACGCTTTTCG
ATATCATACGTGAGGAATACGCCAAAGAAGGGCACAAAGATCGTACCACGTGGCAAATATTCCGTGAGAAACTCCGACTC
AAACGAACCGGTTCTGCTTGGACCTCGTCTCTTCTTATCCCTGCTTCGGATATCCTTATCCCTAATCCCAAACACCTTGG
AACAGCGTTCCGGTCACAATCCGCCGGTTTAGCCAACGTTAACATCCGTGAACTAGTGAACGTCATTCCGATGTCAGATC
CACCTGGTTCTTCAGGACGCGCTATGTTCACGCGCGGATCTTCAATGCGGGTCGGGTCGAGTAAAAACCCGGACGACTCA
CCTGACATCAACATTTTAGGCGATGGACCACCGTCTAGGAGCTTTAAACCGCAGTTATCACGGCACGATTCCGTTAGAGA
TCACAGTGACGGAGAAGAAGATACGAGACGCCGTCATCCGATCGTCACGTTCGTGGAAGAGAGGCAGATGTCGGCGAGAG
AGGCGGTTGCGGCTCAAGAAGCTGCGGAAGCGGAAGCTGCGGCGGCTGGAGGAAGCGAAGATGAAGATGACGATGACGAC
AATGAAGAGGACGATTCAGGAGAAACAGAGGAGAAGAAATCATCGTCAGCTTCTGCACCGAAGCAAACGATGTCGTTGAT
GGATCTGTTGGAAGAGACAGATCGACAGATGGGGTTAACAGGATCAAGATACGCCATGGATGACGATGAAGAGTACGAAG
AAGACGAAGAAGATGAGAATTACGAGGAAGAAGGAGATGGTCACGATGGTGGAGAAGGAGAGCTTAGCTGCTGCGCTTGC
ATGGTGAAAATCAAAGGCGCATCTTTCACTCCTTGTGGTCACACGTTTTGTAAGCTCTGTTCTAAAGAGCTTATGGCTCA
GAAAGGCCATTGTCCTGTTTGCAGCAGCTTCGTCGTTGAGTTCCTTGAGATCTTTTAG