Details for Capsella Locus Carubv10015583m

Position : scaf_3 ( 5`- 1896466 .. 1896972 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015583m

Protein [Map View]
MKTSKMKFTKEMMESIKDKLPRLSFLLLFLRQCYGGCGDRTHLLPCSIATTSTRFWNLSDRPVELQIRVGSVLKRVHTLK
PGRSKRLRHSNIHRAYVDDQEGRRWLYYDETCLPYVWVHETGTDLSKMVKQQYVSLEDLRDYSEIKVFKDLHRGCVSVEK
RDRASALC*

DNA
ATGAAAACATCAAAAATGAAGTTCACAAAAGAGATGATGGAGTCTATCAAAGACAAGCTCCCAAGACTCAGCTTTCTCCT
ACTCTTCCTTCGTCAATGCTACGGTGGTTGCGGGGACCGAACCCATTTACTCCCTTGCTCCATCGCCACCACTTCAACCC
GCTTTTGGAACCTCTCTGACCGTCCCGTGGAGCTCCAGATTCGGGTCGGTTCAGTCCTAAAACGGGTCCACACTCTCAAA
CCCGGGCGTTCCAAGAGGCTAAGACACAGCAACATACACAGAGCTTACGTGGATGACCAGGAAGGACGTAGGTGGTTGTA
CTACGACGAAACGTGTCTACCGTACGTATGGGTGCACGAGACCGGTACGGACTTGTCGAAGATGGTCAAGCAACAGTACG
TGAGTCTCGAGGATCTGAGGGATTACTCGGAGATTAAGGTTTTTAAGGATTTACATAGAGGTTGTGTCTCAGTTGAGAAA
AGAGACAGAGCTTCTGCTTTGTGTTGA