Details for Capsella Locus Carubv10015579m

Position : scaf_3 ( 5`- 2792263 .. 2793309 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015579m

Protein [Map View]
MGIQKLLWEVAKKSFTGGIIGLTISDRCCSVVPVRGDSMSPTMNPLKNSYLDDYVLVDKFCLKDYKFARVQGRVTRVVWP
PQRVSKIGR*

DNA
ATGGGAATCCAGAAACTTTTGTGGGAAGTAGCAAAGAAATCATTCACTGGAGGTATTATAGGGCTTACCATTTCAGATAG
ATGTTGTAGTGTTGTTCCGGTGAGAGGAGATTCCATGTCTCCGACAATGAATCCCCTGAAAAATTCCTATTTAGATGATT
ATGTACTCGTGGATAAATTTTGCCTTAAGGATTACAAGTTTGCTCGTGTTCAAGGACGGGTCACTCGTGTGGTGTGGCCT
CCTCAAAGAGTAAGCAAGATTGGTCGATAA