Details for Capsella Locus Carubv10015574m

Position : scaf_3 ( 5`- 6353445 .. 6355055 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015574m

Protein [Map View]
MAAVAAPMASKPRGSKAESFVDNKRREDIRFANINSARAVSDAVRTSLGPKGMDKMISTANGEVIITNDGATILNKMEVL
QPAAKMLVELSKSQDSAAGDGTTTVVVIAGALLKECQSLLTNGIHPTVISDSLHKACGKAIDILTAMAVPVELTDRDSLV
KSASTSLNSKVVSQYSTLLAPLAVDAVLSVIDPEKPDIVDLRDIKIVKKLGGTVDDTHTVKGLVFDKKVSRAAGGPTRVE
NAKIAVIQFQISPPKTDIEQSIVVSDYTQMDRILKEERNYILGMIKKIKATGCNVLLIQKSILRDAVTDLSLHYLAKAKI
MVIKDVERDEIEFVTKTLNCLPIANIEHFRAEKLGHADLVEEASLGDGKILKITGIKDMGRTTSVLVRGSNQLVLDEAER
SLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLHGMEGYCVKSFAEALEVIPYTLAENAGLNPIAIVTELRNK
HAQGEINSGINVRKGQITNILEENVVQPLLVSTSAITLATECVRMILKIDDIVTVR*

DNA
ATGGCGGCGGTAGCGGCACCGATGGCATCGAAACCCCGTGGATCTAAAGCAGAGTCGTTCGTAGACAACAAGCGTAGAGA
AGATATCAGATTCGCCAACATCAACTCTGCTCGCGCCGTCTCAGACGCCGTCCGTACGAGTTTGGGCCCTAAGGGTATGG
ACAAGATGATTTCCACGGCGAACGGAGAGGTTATCATCACTAACGATGGAGCTACGATCCTCAACAAGATGGAGGTTTTG
CAGCCAGCAGCGAAGATGTTGGTCGAGCTTTCTAAATCACAAGATTCAGCTGCCGGAGATGGTACCACCACTGTTGTTGT
AATCGCCGGTGCACTACTCAAGGAGTGTCAATCGCTTCTTACGAACGGGATCCACCCTACTGTTATTTCAGATTCGCTTC
ACAAGGCTTGTGGTAAGGCAATTGATATTTTGACGGCCATGGCTGTTCCGGTGGAGCTCACTGATCGAGATTCACTTGTT
AAATCTGCGAGCACGTCGCTTAACAGTAAGGTTGTTAGTCAGTACTCTACATTACTTGCTCCTTTAGCTGTAGATGCGGT
TCTTTCTGTTATAGATCCGGAAAAGCCAGATATTGTGGATTTGCGTGATATTAAGATTGTTAAGAAGCTTGGTGGGACTG
TGGATGATACACATACGGTGAAAGGTTTGGTTTTTGACAAGAAGGTTAGCCGTGCTGCTGGTGGACCAACTCGTGTGGAG
AATGCTAAGATCGCTGTGATTCAGTTCCAGATCTCACCTCCGAAGACTGACATTGAGCAGAGTATTGTTGTCTCTGACTA
TACTCAGATGGATAGAATCTTGAAAGAAGAGAGGAATTACATCTTGGGGATGATTAAGAAGATCAAAGCCACTGGTTGCA
ATGTGTTGCTCATCCAGAAGAGTATTTTGAGGGATGCGGTGACTGATCTATCACTTCACTATTTGGCCAAAGCTAAAATC
ATGGTTATCAAGGATGTAGAGAGAGATGAGATTGAATTCGTCACCAAGACATTGAACTGCTTGCCAATCGCCAATATTGA
ACATTTCAGAGCTGAGAAGCTTGGTCATGCTGATCTTGTTGAAGAAGCCTCCCTTGGAGATGGAAAGATTTTGAAGATCA
CTGGAATCAAAGACATGGGAAGAACTACATCTGTTCTTGTCCGTGGCTCCAACCAGCTTGTTCTAGATGAAGCTGAAAGG
AGTTTACATGATGCGTTATGTGTGGTTAGGTGTTTGGTGAGCAAGAGGTTCTTGATTGCAGGAGGTGGGGCACCAGAGAT
TGAGCTCTCAAGGCAGCTTGGTGCTTGGGCTAAGGTTCTCCATGGAATGGAAGGTTACTGTGTGAAGTCTTTTGCTGAAG
CTCTTGAGGTCATTCCTTACACACTTGCCGAGAATGCAGGGTTAAACCCTATCGCCATTGTGACTGAACTCAGAAACAAG
CATGCTCAAGGAGAAATCAACTCGGGTATCAATGTGAGGAAAGGACAAATCACCAATATCTTGGAGGAAAATGTTGTTCA
GCCCCTGCTTGTGAGTACCAGTGCAATCACTCTAGCAACTGAATGTGTAAGGATGATTTTGAAGATTGATGACATCGTTA
CTGTGAGGTAG