Details for Capsella Locus Carubv10015571m

Position : scaf_3 ( 5`- 2998324 .. 2999475 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015571m

Protein [Map View]
RAFCSFSSSLLPVSLAVVNMGKTRGMGAGRKLKRLRINQRWADKSYKKSHQGNEWKKPFAGSSHAKGIVLEKIGIEAKQP
NSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR
S*

DNA
CGCGCCTTCTGCAGTTTCAGCTCATCTCTCTTACCTGTATCTCTCGCCGTCGTCAACATGGGTAAGACACGTGGTATGGG
AGCTGGGCGCAAGCTTAAGAGGCTTCGGATTAACCAGAGGTGGGCAGACAAGAGTTACAAGAAGTCTCACCAAGGTAACG
AGTGGAAGAAGCCTTTTGCTGGATCATCTCACGCTAAAGGAATCGTCCTTGAGAAGATTGGTATTGAGGCTAAGCAGCCT
AACTCTGCCATCCGTAAGTGTGCTAGAGTTCAGTTGATCAAGAACGGCAAAAAGATTGCTGCTTTTGTCCCCAATGATGG
TTGTTTGAACTACATTGAAGAAAATGACGAGGTGTTGATTGCTGGATTTGGGCGTAAAGGTCATGCTGTTGGAGATATTC
CCGGAGTTAGGTTTAAGGTGGTGAAGGTTTCTGGTGTCTCACTTTTGGCGCTTTTCAAGGAAAAGAAGGAGAAGCCTAGG
TCTTAA