Details for Capsella Locus Carubv10015570m

Position : scaf_3 ( 5`- 6585742 .. 6586900 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015570m

Protein [Map View]
MPLYDCMLLFKPIIRKEGLIELVARIGKHVYSRNGVLTDVKSFGKVELGYGIRKLDGRHYQGQLMQITMMATPNMNKELH
YLNKEDKLLRWLLVKHRDVQIGHSDRDENLTDHSRHTSGSLFDGSSTDEDDDNILGLSR*

DNA
ATGCCGCTCTACGACTGTATGCTTCTGTTCAAACCAATAATCAGAAAGGAAGGCCTCATCGAACTCGTTGCGCGCATTGG
GAAACACGTTTACAGCAGAAATGGTGTCCTCACCGACGTCAAATCCTTTGGCAAGGTCGAATTGGGTTACGGTATTAGGA
AGCTCGACGGAAGACACTATCAGGGACAATTGATGCAAATAACAATGATGGCAACTCCAAACATGAACAAGGAGCTTCAC
TACCTCAACAAGGAAGACAAACTGCTGCGCTGGCTCCTAGTTAAACACCGCGACGTCCAGATCGGACACTCTGATAGGGA
CGAGAATCTGACTGATCATAGCAGGCATACTAGTGGGAGCTTATTCGACGGATCCTCTACAGACGAAGATGATGACAACA
TTTTAGGTTTATCACGATGA