Details for Capsella Locus Carubv10015569m

Position : scaf_3 ( 5`- 3088152 .. 3089007 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015569m

Protein [Map View]
MAQKITTLVLLIEILFLVSCLSHFTTTKADNDGDVIHVAGKVMCQDCSLNYDKWINGSEPIKGAVVSITCMDERRRVRYY
GSDKTDERGQFDLIVNNVLYGGKDLKPQLCNVRLVSSPDQSCNIPTNFGNGQTGVKLVRPFMVFKDLVKYVVGPFYYTTP
MCETPKFENNY*

DNA
ATGGCGCAAAAGATCACAACATTGGTTCTGCTAATAGAGATATTGTTTCTGGTGAGTTGTCTGAGTCATTTCACCACGAC
AAAGGCGGACAATGATGGTGATGTCATTCACGTCGCCGGGAAAGTTATGTGCCAAGATTGCTCTCTGAACTACGACAAAT
GGATCAACGGTTCTGAACCCATCAAAGGGGCAGTGGTATCAATCACTTGTATGGACGAAAGGAGAAGAGTGAGATACTAT
GGGAGCGACAAGACAGATGAGAGAGGCCAGTTCGATCTAATAGTCAACAATGTCCTCTACGGCGGCAAGGATCTCAAGCC
TCAACTTTGTAATGTCCGGCTCGTGTCTTCTCCGGACCAGTCATGTAACATTCCCACCAATTTTGGCAATGGTCAAACCG
GAGTGAAGCTAGTTCGACCATTCATGGTTTTCAAGGATCTGGTTAAGTATGTCGTCGGACCATTTTATTACACCACTCCC
ATGTGTGAGACGCCTAAATTTGAAAACAACTACTAA