Details for Capsella Locus Carubv10015556m

Position : scaf_3 ( 5`- 8365497 .. 8366045 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015556m

Protein [Map View]
MINRKRPRKTQEISFYETPSDCSEEEIQRSCEFLRKVKELDDKTIFVRFADAVKCYQSKSLSYKYLKTKVAYILRNHDVL
LEQFHQLMSDLATKEATKEENRDAVKSDVERTVEFLNKLEATGKGLHGAFLNAFAFDGDIVALVENLDVVLRDHACLKEE
FKAFLIDSRLLKKNRNAVLRRP*

DNA
ATGATAAATCGCAAGAGACCTCGGAAGACTCAAGAGATAAGTTTTTATGAAACTCCATCGGATTGTTCTGAAGAAGAGAT
TCAACGGAGTTGTGAGTTTTTGAGGAAAGTGAAAGAGTTGGATGATAAGACAATCTTCGTTAGATTTGCCGATGCAGTGA
AGTGTTATCAATCTAAGTCTTTAAGCTACAAGTATCTCAAAACCAAAGTCGCTTACATTCTCCGTAATCACGATGTTTTG
CTCGAACAATTCCATCAACTTATGTCGGATTTAGCAACCAAAGAAGCAACCAAAGAAGAGAATCGTGACGCCGTGAAATC
AGACGTGGAACGCACGGTTGAGTTTTTGAACAAACTCGAAGCTACGGGGAAGGGTTTACACGGTGCGTTTCTAAATGCGT
TTGCGTTTGACGGTGATATCGTGGCGCTGGTTGAAAACCTCGACGTGGTTTTACGCGATCACGCGTGTCTCAAAGAGGAG
TTTAAAGCGTTCTTAATCGATTCCCGTTTACTCAAAAAAAACCGAAACGCGGTTCTGAGGCGGCCGTAG