Details for Capsella Locus Carubv10015553m

Position : scaf_3 ( 5`- 4931266 .. 4931901 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015553m

Protein [Map View]
MDKTDQTAIDGSALELNRTEKTAEASLRVVSMALSIVGLVIMIKNSISNDFGSISYSNLGAFMYLVIANGVCAAYSLLSA
LAILALPCPISKLQVWTLFLLDQVVTYLVLAAGSVSAETVYLAYYGNIPITWSSACDSYGIFCHKALISVVFTFVVSLLY
MLLSLVSSYRLFSRFEAP*

DNA
ATGGACAAGACTGATCAAACAGCCATTGACGGCTCAGCTTTAGAGCTTAATCGCACTGAGAAAACAGCAGAGGCGTCCCT
GCGAGTTGTATCAATGGCTCTAAGTATTGTGGGTCTCGTCATCATGATCAAGAACTCTATCTCCAACGACTTTGGCTCTA
TCTCTTACTCAAATCTTGGAGCTTTCATGTATTTGGTGATTGCTAATGGCGTTTGTGCAGCATATTCTCTTCTCTCTGCT
CTCGCAATATTAGCCCTTCCGTGTCCAATAAGCAAGCTCCAAGTGTGGACATTGTTCTTGCTTGACCAGGTGGTCACGTA
CCTGGTTCTAGCGGCTGGGTCTGTATCTGCTGAGACGGTTTACTTAGCATACTATGGAAACATACCCATCACTTGGAGCT
CTGCTTGTGACTCATACGGAATCTTCTGTCACAAGGCATTGATCTCGGTTGTGTTCACGTTCGTTGTCTCCCTTCTCTAC
ATGTTGCTCTCGCTCGTCTCTTCCTATCGACTCTTCAGCAGATTTGAAGCACCATAA