Details for Capsella Locus Carubv10015552m

Position : scaf_3 ( 5`- 7786822 .. 7787411 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015552m

Protein [Map View]
MTKEKKKDNVRYMDVELNVSMHCNECERKIARVISKFKGVETFVTDMNSHKVVVTGKIDPKKLVKKLKKKTGKRAKIVVK
EEKDEESSKDADNENVLEIDMEPIGLGDDEWCNYDWEMEKFMVFSDENPKAICSIS*

DNA
ATGACGAAAGAAAAGAAAAAGGACAACGTCAGATATATGGATGTCGAACTCAACGTATCGATGCATTGCAACGAATGCGA
GAGAAAAATCGCTAGAGTTATTTCCAAATTCAAAGGAGTTGAGACGTTTGTTACGGATATGAATAGTCACAAGGTTGTGG
TCACGGGTAAGATCGATCCGAAGAAGTTGGTGAAGAAACTCAAGAAGAAGACAGGCAAAAGAGCGAAGATTGTAGTCAAG
GAAGAGAAAGATGAAGAGTCTAGTAAAGACGCTGATAATGAAAATGTTCTCGAGATTGATATGGAACCGATTGGTTTAGG
CGATGATGAATGGTGTAATTATGATTGGGAGATGGAGAAATTTATGGTGTTTAGCGACGAAAACCCTAAAGCTATATGTT
CTATTTCTTAG